Recombinant Full Length Drosophila Melanogaster Odorant Receptor 33A(Or33A) Protein, His-Tagged
Cat.No. : | RFL7544DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 33a(Or33a) Protein (P81914) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDSRRKVRSENLYKTYWLYWRLLGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQ IQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRV ARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSS LLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLM KIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSC YYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFF ATVRMAYSFYTLALSFRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or33a |
Synonyms | Or33a; AN3; DOR33B.1; dor73; Or33B.1; CG16960; Odorant receptor 33a |
UniProt ID | P81914 |
◆ Recombinant Proteins | ||
CASP10-557H | Recombinant Human CASP10 | +Inquiry |
HSDL2-2593R | Recombinant Rat HSDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOVL2-3261H | Recombinant Human ELOVL2 Protein, GST-tagged | +Inquiry |
TGM23880H | Recombinant Human Transglutaminase 2 (1-687) Protein | +Inquiry |
CTCF-15H | Recombinant Human CTCF protein | +Inquiry |
◆ Native Proteins | ||
Heparin-200S | Active Native Swine Heparin | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC18-496HCL | Recombinant Human DNAJC18 cell lysate | +Inquiry |
PTPLB-2687HCL | Recombinant Human PTPLB 293 Cell Lysate | +Inquiry |
SCFD2-1566HCL | Recombinant Human SCFD2 cell lysate | +Inquiry |
KIAA1429-4964HCL | Recombinant Human KIAA1429 293 Cell Lysate | +Inquiry |
PCCB-1291HCL | Recombinant Human PCCB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or33a Products
Required fields are marked with *
My Review for All Or33a Products
Required fields are marked with *
0
Inquiry Basket