Recombinant Full Length Drosophila Melanogaster Odorant Receptor 23A(Or23A) Protein, His-Tagged
Cat.No. : | RFL15573DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 23a(Or23a) Protein (P81912) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MKLSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDP VENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHL LRMSKLFQITYAVVFIIAAVPFVFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYVF QIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCIRDQNALYRL LDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYY GTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVAC WKGAYSFFTLMADRDGLGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or23a |
Synonyms | Or23a; AN5; DOR23A.1; dor64; Or23A.1; CG9880; Odorant receptor 23a |
UniProt ID | P81912 |
◆ Recombinant Proteins | ||
lexA-131E | Recombinant E. coli LexA | +Inquiry |
EAR14-2607M | Recombinant Mouse EAR14 Protein, His (Fc)-Avi-tagged | +Inquiry |
CuSe-028 | CuSe nanoparticles | +Inquiry |
ACHE-2476B | Recombinant Bovine ACHE protein, GST-tagged | +Inquiry |
HEMK1-3476HF | Recombinant Full Length Human HEMK1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
TSH-108H | Active Native Human Thyroid Stimulating Hormone | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cecum-606R | Rat Cecum Lysate, Total Protein | +Inquiry |
HA-2604HCL | Recombinant H3N2 HA cell lysate | +Inquiry |
NLRP12-3801HCL | Recombinant Human NLRP12 293 Cell Lysate | +Inquiry |
IPO13-5182HCL | Recombinant Human IPO13 293 Cell Lysate | +Inquiry |
Kidney-843P | Pig Kidney Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or23a Products
Required fields are marked with *
My Review for All Or23a Products
Required fields are marked with *
0
Inquiry Basket