Recombinant Full Length Drosophila Melanogaster Neuropeptide Y Receptor(Nepyr) Protein, His-Tagged
Cat.No. : | RFL24951DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Neuropeptide Y receptor(NepYr) Protein (P25931) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MEHHNSHLLPGGSEKMYYIAHQQPMLRNEDDNYQEGYFIRPDPASLIYNTTALPADDEGS NYGYGSTTTLSGLQFETYNITVMMNFSCDDYDLLSEDMWSSAYFKIIVYMLYIPIFIFAL IGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCH FVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPIP IVSGLDIPMSPWHTKCEKYICREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIR VWAKRPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP LPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQLMHRMPGLRRWCCLRSVGDRMNAT SGTGPALPLNRMNTSTTYISARRKPRATSLRANPLSCGETSPLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RYa-R |
Synonyms | RYa-R; NepYr; CG5811; RYamide receptor; Neuropeptide Y-like receptor; NPY-R |
UniProt ID | P25931 |
◆ Recombinant Proteins | ||
Serpinb2-5788M | Recombinant Mouse Serpinb2 Protein, Myc/DDK-tagged | +Inquiry |
HIST3H3-299H | Recombinant Human HIST3H3 protein, His-tagged | +Inquiry |
MCM8-2526R | Recombinant Rhesus Macaque MCM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAE1-33H | Recombinant Active Human NAE1/UBA3 Complex Protein, His/GST-tagged | +Inquiry |
OLIG2-1769HFL | Recombinant Full Length Human OLIG2 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM42-775HCL | Recombinant Human TRIM42 293 Cell Lysate | +Inquiry |
TUBGCP2-642HCL | Recombinant Human TUBGCP2 293 Cell Lysate | +Inquiry |
LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
Arabidopsis-389P | Plant Plant: Arabidopsis Lysate | +Inquiry |
MOSPD1-4244HCL | Recombinant Human MOSPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RYa-R Products
Required fields are marked with *
My Review for All RYa-R Products
Required fields are marked with *
0
Inquiry Basket