Recombinant Full Length Drosophila Melanogaster Metallophosphoesterase 1 Homolog(Cg8455) Protein, His-Tagged
Cat.No. : | RFL2386DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Metallophosphoesterase 1 homolog(CG8455) Protein (Q9VLR9) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MRFLYACFVIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLGPHR GHWLDKLYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHL PPGIPLISVAGNHDVGFHYKMHPFFMSRFESYLNNSSVNLYTIKQIHFVVINSMAMEGDG CMFCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTMCEEHD APYIEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVASFSWRN KVNPSFMLATITPDDYVVSKCKMLPQQFVFNSYLSAGILCLIVIGFQLRKCIQSRRQSSA VDHRKVNYLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PGAP5 |
Synonyms | PGAP5; CG8455; Metallophosphoesterase 1 homolog; Post-GPI attachment to proteins 5 ortholog |
UniProt ID | Q9VLR9 |
◆ Recombinant Proteins | ||
IRF1-4332H | Recombinant Human IRF1 protein, His&GST-tagged | +Inquiry |
MMP2-6516HF | Recombinant Full Length Human MMP2 Protein, GST-tagged | +Inquiry |
MYL12A-3606H | Recombinant Human MYL12A, His-tagged | +Inquiry |
ATOX1-26191TH | Recombinant Human ATOX1, His-tagged | +Inquiry |
N-2425V | Recombinant COVID-19 N protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
ALP-8330C | Native Calf ALP | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL11A-4360HCL | Recombinant Human METTL11A 293 Cell Lysate | +Inquiry |
LIFR-2778HCL | Recombinant Human LIFR cell lysate | +Inquiry |
PtK2-1434M | PtK2 (Marsupial kidney) whole cell lysate | +Inquiry |
Testis-511H | Human Testis Membrane Lysate | +Inquiry |
Aorta-634B | Bovine Aorta Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGAP5 Products
Required fields are marked with *
My Review for All PGAP5 Products
Required fields are marked with *
0
Inquiry Basket