Recombinant Full Length Drosophila Melanogaster Innexin Inx6(Inx6) Protein, His-Tagged
Cat.No. : | RFL5796DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Innexin inx6(inx6) Protein (Q9VR82) (1-481aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-481) |
Form : | Lyophilized powder |
AA Sequence : | MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQ ADYVQSYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYAR FISIAEGVGPETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEV GDALIVEATYRTRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNG FWYKYIHALAAIPVYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILN EKIFAVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGY GDWFVLMCVSINVNPTLFRELLEQLYAKLNQARCTEPVFAEQPCQQVPQLAQVPQLFSHA KLDRCPSRNCSLLIDPTADRHSICTESSHRVTAMPTAPTLNLMAPNDEIISMDRFFHESH A |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Inx6 |
Synonyms | Inx6; prp6; CG17063; Innexin inx6; Innexin-6; Gap junction protein prp6; Pas-related protein 6 |
UniProt ID | Q9VR82 |
◆ Native Proteins | ||
Lectin-1721P | Native Peanut Lectin | +Inquiry |
FGA-79H | Active Native Human Fibrinogen | +Inquiry |
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDND1-7456HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
KCTD15-891HCL | Recombinant Human KCTD15 cell lysate | +Inquiry |
ACTN1-9056HCL | Recombinant Human ACTN1 293 Cell Lysate | +Inquiry |
THAP4-1773HCL | Recombinant Human THAP4 cell lysate | +Inquiry |
NFE2L2-3854HCL | Recombinant Human NFE2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Inx6 Products
Required fields are marked with *
My Review for All Inx6 Products
Required fields are marked with *
0
Inquiry Basket