Recombinant Full Length Drosophila Melanogaster G-Protein Coupled Receptor Mth(Mth) Protein, His-Tagged
Cat.No. : | RFL3631DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster G-protein coupled receptor Mth(mth) Protein (O97148) (25-514aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-514) |
Form : | Lyophilized powder |
AA Sequence : | DILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHIRGCV CKLKPCVRFCCPHDHIMDNGVCYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNELIVQW DLPMPCDGMFYLDNREEQDKYTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRI APHNCLIVPSITGQTVVMISSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFL LLDLWQISISFCKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAY NTYAWGMAVVLTGITVLADNIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAF NITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSY FSQSNQTWANVFLVADYLNWSQGIIIFILFVLKRSTWRLLQESIRGEGEEVNNSEEEISL ENTTTRNVLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mth |
Synonyms | mth; CG6936; G-protein coupled receptor Mth; Protein methuselah |
UniProt ID | O97148 |
◆ Recombinant Proteins | ||
TAS2R116-9003M | Recombinant Mouse TAS2R116 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPSM-2985S | Recombinant Staphylococcus epidermidis ATCC 12228 RPSM protein, His-tagged | +Inquiry |
PHOX2A-4091R | Recombinant Rat PHOX2A Protein, His (Fc)-Avi-tagged | +Inquiry |
HDAC9-2912H | Recombinant Human HDAC9 Protein (Gln628-Ser1005), N-His tagged | +Inquiry |
FGF2-18H | Active Recombinant Human FGF2 Protein (143-288aa), Non-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
Collagen-45R | Native Rat Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUK-676HCL | Recombinant Human FUK cell lysate | +Inquiry |
MAPK7-4490HCL | Recombinant Human MAPK7 293 Cell Lysate | +Inquiry |
KIAA1199-915HCL | Recombinant Human KIAA1199 cell lysate | +Inquiry |
RIOK2-2335HCL | Recombinant Human RIOK2 293 Cell Lysate | +Inquiry |
XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mth Products
Required fields are marked with *
My Review for All mth Products
Required fields are marked with *
0
Inquiry Basket