Recombinant Full Length Drosophila Melanogaster Fmrfamide Receptor(Fr) Protein, His-Tagged
Cat.No. : | RFL20358DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster FMRFamide receptor(FR) Protein (Q9VZW5) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MSGTAVARLLLRLELPSPGVMPPPPTDYDYGGPISDDEFLASAMATEGPTVRYDLFPQNN SQPTLQIVLNHTEVQTDLQYPHYEDLGLDPDPNWTRICEDVYNPLLENNRIEFWVCGVLI NIVGVLGILGNIISMIILSRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGH FFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIY FIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVN YIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVL NISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSRDQPDL IHYESSISNNGDGTLNHRSSGRFSRHGTQRSTTTTYLVATGGPGGGGCGGGGGNNSLNNV RLTQVSGSPGLVKIKRNRAPSPGPVVYFPAREMQRSASTTNSTTNNNTSIGYDWTLPDSK KLGHVSSGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FR |
Synonyms | FMRFaR; FR; CG2114; FMRFamide receptor; DFR; DrmFMRFa-R |
UniProt ID | Q9VZW5 |
◆ Recombinant Proteins | ||
LIGB-0973B | Recombinant Bacillus subtilis LIGB protein, His-tagged | +Inquiry |
CEACAM5-1095H | Recombinant Human CEACAM5 Protein, GST-Tagged | +Inquiry |
VPS36-3679H | Recombinant Human VPS36, His-tagged | +Inquiry |
YKTD-1204B | Recombinant Bacillus subtilis YKTD protein, His-tagged | +Inquiry |
OXR1-1031HFL | Active Recombinant Full Length Human OXR1 Protein, N-His-tagged | +Inquiry |
◆ Native Proteins | ||
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RND3-2312HCL | Recombinant Human RND3 293 Cell Lysate | +Inquiry |
Fetal Umbilical Cord-179H | Human Fetal Umbilical Cord Lysate | +Inquiry |
PPAPDC1A-2990HCL | Recombinant Human PPAPDC1A 293 Cell Lysate | +Inquiry |
GMFG-5882HCL | Recombinant Human GMFG 293 Cell Lysate | +Inquiry |
ZFP82-177HCL | Recombinant Human ZFP82 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FR Products
Required fields are marked with *
My Review for All FR Products
Required fields are marked with *
0
Inquiry Basket