Recombinant Full Length Drosophila Melanogaster Fit Family Protein Cg10671(Cg10671) Protein, His-Tagged
Cat.No. : | RFL873DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster FIT family protein CG10671(CG10671) Protein (Q9VRJ2) (1-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-423) |
Form : | Lyophilized powder |
AA Sequence : | MATKRRPLRPNLGGTAGSPSSSGSNMNFRPGGPDITRSEARGTRPTAAPTSIREILVMGV IHLCKKTIFFNTDLKVALYLGSLFVISVIGDFVPFPKTYFARSDNLFNQYFVKIGWGWTL LFVVPFLVLSAYTITCGDHKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRCTTKGYA TKSSCLKAGHLWKGFDISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAEN SGTNPLRTLNEEQMRSLQFLYKRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKV ISGIIAILTWYFTYRFWYPTPGLLPEAPGNGSFSYQREIPTFPFKRPSHLSTGAATTSSG SNSSRTNLNGKAATTGVPRDQQIPTFMGMPLFTSPKAASAAANLLMSDQQKRERDREQQT LES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG10671 |
Synonyms | Fitm2; Fit2; Fitm; CG10671; Acyl-coenzyme A diphosphatase FITM2; Fat storage-inducing transmembrane protein; Fat storage-inducing transmembrane protein 2; Fat-inducing protein 2 |
UniProt ID | Q9VRJ2 |
◆ Recombinant Proteins | ||
NTMT1-12154Z | Recombinant Zebrafish NTMT1 | +Inquiry |
ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
TAS2R143-5620R | Recombinant Rat TAS2R143 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLS-990H | Recombinant Human GLS Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-8978M | Recombinant Mouse TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDH1-168HCL | Recombinant Human BDH1 cell lysate | +Inquiry |
LOC389174-4687HCL | Recombinant Human LOC389174 293 Cell Lysate | +Inquiry |
SYT5-1303HCL | Recombinant Human SYT5 293 Cell Lysate | +Inquiry |
Skin-144R | Rat Skin Tissue Lysate | +Inquiry |
SCIN-1568HCL | Recombinant Human SCIN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG10671 Products
Required fields are marked with *
My Review for All CG10671 Products
Required fields are marked with *
0
Inquiry Basket