Recombinant Full Length Drosophila Melanogaster Dopamine Receptor 2(Dopr2) Protein, His-Tagged
Cat.No. : | RFL24248DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Dopamine receptor 2(DopR2) Protein (Q24563) (1-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-539) |
Form : | Lyophilized powder |
AA Sequence : | MVDDNGSSPEVEGAEGAGAPLLALLRVDGLNQTQTRSPSPSFFGSYNISEDVYFYFNGLP TSTELVLNATTSATSATLSPAMVATGGGGTTTPEPDLSEFLEALPNDRVGLLAFLFLFSF ATVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTD WCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAI SFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQT RSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHS HHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKKAAKT LGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRD FRRAFVRLLCMCCPRKIRRKYQPTMRSKSQRFATRRCYSTCSLHGIQHVRHNSCEQTYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dop1R2 |
Synonyms | Dop1R2; DAMB; DopR2; DopR99B; CG18741; Dopamine receptor 2; Dopamine 1-like receptor 2 |
UniProt ID | Q24563 |
◆ Recombinant Proteins | ||
GOLGA6A-5109H | Recombinant Human GOLGA6A Protein, GST-tagged | +Inquiry |
RFL2331AF | Recombinant Full Length Anopheles Gambiae Kynurenine 3-Monooxygenase(Kh) Protein, His-Tagged | +Inquiry |
TMEM223-1021Z | Recombinant Zebrafish TMEM223 | +Inquiry |
TXNDC5-1108H | Recombinant Human TXNDC Protein, MYC/DDK-tagged | +Inquiry |
E-01S | Recombinant SARS-CoV-2 B.1.617 Variant (India) Spike RBD (L452R/E484Q) Mutant Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf88-8057HCL | Recombinant Human C2orf88 293 Cell Lysate | +Inquiry |
BTG4-193HCL | Recombinant Human BTG4 cell lysate | +Inquiry |
ADCY3-9021HCL | Recombinant Human ADCY3 293 Cell Lysate | +Inquiry |
SPON2-1503HCL | Recombinant Human SPON2 293 Cell Lysate | +Inquiry |
IFNGR2-1899MCL | Recombinant Mouse IFNGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dop1R2 Products
Required fields are marked with *
My Review for All Dop1R2 Products
Required fields are marked with *
0
Inquiry Basket