Recombinant Full Length Anopheles Gambiae Kynurenine 3-Monooxygenase(Kh) Protein, His-Tagged
Cat.No. : | RFL2331AF |
Product Overview : | Recombinant Full Length Anopheles gambiae Kynurenine 3-monooxygenase(kh) Protein (Q7Q6A7) (1-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anopheles gambiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-486) |
Form : | Lyophilized powder |
AA Sequence : | MATASDSKYKRTNTNGMQHQPLDVAIVGGGLVGSLLALHLGKKGHEVNLYEYREDIRTAE LVIGRSINLALSARGRRALAEVGLEDALLNHGIPMSGRMLHDVNGKCKIVPYDANTNQCI YSVGRKHLNEVLLNAAEKYPNIHLHFNHKLVSANLDEGNLSMVDPVTKDVKSARADLIVG CDGAYSAVRKEIVKRPRYDFSQTYIEHGYLELCIPPTAGGEFAMPHNYLHIWPRGQFMMI ALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIELIGRERLVKDFFKTKAQP LVMIKCRPYHIGAKALIIGDAAHAMVPFYGQGMNAGFEDCSVLTELFNQYGTDLARILPE FSEKRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNTWVPLYNSVSFS HMRYSKCIANRAWQDKILTRVLYGASIASVAAIGGLCYRHVTMGHLERLSTRILSTFQLL KPKASV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kh |
Synonyms | kh; AGAP005948; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase |
UniProt ID | Q7Q6A7 |
◆ Recombinant Proteins | ||
TMEM242-2217H | Recombinant Human TMEM242 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ITGAV&ITGB6-759H | Active Recombinant Human ITGAV&ITGB6 protein, His-tagged | +Inquiry |
BCAP31-979M | Recombinant Mouse BCAP31 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAP1B-3602R | Recombinant Rhesus Macaque RAP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
SKINT6-15180M | Recombinant Mouse SKINT6 Protein | +Inquiry |
◆ Native Proteins | ||
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHC-4787HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
BEX2-8463HCL | Recombinant Human BEX2 293 Cell Lysate | +Inquiry |
RNF41-2274HCL | Recombinant Human RNF41 293 Cell Lysate | +Inquiry |
ARHGEF25-5962HCL | Recombinant Human GEFT 293 Cell Lysate | +Inquiry |
RDM1-2434HCL | Recombinant Human RDM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kh Products
Required fields are marked with *
My Review for All kh Products
Required fields are marked with *
0
Inquiry Basket