Recombinant Full Length Drosophila Melanogaster Adipor-Like Receptor Cg5315(Cg5315) Protein, His-Tagged
Cat.No. : | RFL29531DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster ADIPOR-like receptor CG5315(CG5315) Protein (Q9VCY8) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MDSATNLLEQQGSAADVSGGSHPAEVEVTTQARATFGMDAEGHATGEAVTTTTATLRREG SDEDIFEQVQMILRKRRGWGPEDSLSPNDLDILEYDDELVEEDDAGCPLPSTPEDTQLIE AEMTEVLKAGVLSDEIDLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLH RGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVF GAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQ PKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFS QMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYH GISEMAMYRVMYSECTVPIEPITF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AdipoR |
Synonyms | AdipoR; CG5315; Adiponectin receptor protein |
UniProt ID | Q9VCY8 |
◆ Recombinant Proteins | ||
STIM1-8132H | Recombinant Human STIM1 protein, His & T7-tagged | +Inquiry |
PKP3-1886H | Recombinant Human PKP3 Protein, MYC/DDK-tagged | +Inquiry |
FXYD2-2077R | Recombinant Rat FXYD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TFPI2-6598H | Recombinant Human TFPI2 Protein (Asp23-Ile230), N-His tagged | +Inquiry |
RAB2A-1808H | Recombinant Human RAB2A protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
HP-133B | Native Bovine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2U-1872HCL | Recombinant Human UBE2U cell lysate | +Inquiry |
RARA-2516HCL | Recombinant Human RARA 293 Cell Lysate | +Inquiry |
EML4-6608HCL | Recombinant Human EML4 293 Cell Lysate | +Inquiry |
LINC00152-4334HCL | Recombinant Human MGC4677 293 Cell Lysate | +Inquiry |
COPRS-8229HCL | Recombinant Human C17orf79 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AdipoR Products
Required fields are marked with *
My Review for All AdipoR Products
Required fields are marked with *
0
Inquiry Basket