Recombinant Full Length Drosophila Melanogaster 5-Hydroxytryptamine Receptor 2B(5-Ht1B) Protein, His-Tagged
Cat.No. : | RFL12960DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster 5-hydroxytryptamine receptor 2B(5-HT1B) Protein (P28286) (1-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-617) |
Form : | Lyophilized powder |
AA Sequence : | MLKTVTTAMAAGDDDVPASILEIELPAILLNESLFIELNGNLTQLVDTTSNLSQIVWNRS INGNGNSNTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERN LQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILH LVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQ HCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQKSFNVTLTETDCDS AVRELKKERSKRRAERKRLEAGERTPVDGDGTGGQLQRRTRKRMRICFGRNTNTANVVAG SEGAVARSMAAIAVDFASLAITREETEFSTSNYDNKSHAGTELTTVSSDADDYRTSNANE IITLSQQVAHATQHHLIASHLNAITPLAQSIAMGGVGCLTTTTPSEKALSGAGTVAGAVA GGSGSGSGEEGAGTEGKNAGVGLGGVLASIANPHQKLAKRRQLLEAKRERKAAQTLAIIT GAFVICWLPFFVMALTMSLCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFK RILFGRKAAARARSAKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | 5-HT1B |
Synonyms | 5-HT1B; 5HT-R2B; CG15113; 5-hydroxytryptamine receptor 2B; 5-HT receptor 2B; 5-hydroxytryptamine receptor 1B; 5-HT receptor 1B; Serotonin receptor 1B; Serotonin receptor 2B |
UniProt ID | P28286 |
◆ Recombinant Proteins | ||
HGD-256H | Recombinant Human HGD Protein, MYC/DDK-tagged | +Inquiry |
ACSS2-219R | Recombinant Rhesus monkey ACSS2 Protein, His-tagged | +Inquiry |
FGD2-2709H | Recombinant Human FGD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIN54-2875H | Recombinant Human LIN54 protein, His-tagged | +Inquiry |
ZDHHC4-10404Z | Recombinant Zebrafish ZDHHC4 | +Inquiry |
◆ Native Proteins | ||
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFPL1-2406HCL | Recombinant Human RFPL1 293 Cell Lysate | +Inquiry |
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
USH1C-1892HCL | Recombinant Human USH1C cell lysate | +Inquiry |
DENND1B-465HCL | Recombinant Human DENND1B cell lysate | +Inquiry |
CHTF8-7503HCL | Recombinant Human CHTF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All 5-HT1B Products
Required fields are marked with *
My Review for All 5-HT1B Products
Required fields are marked with *
0
Inquiry Basket