Recombinant Full Length Drosophila Erecta Putative Gustatory Receptor 59B(Gr59B) Protein, His-Tagged
Cat.No. : | RFL16788DF |
Product Overview : | Recombinant Full Length Drosophila erecta Putative gustatory receptor 59b(Gr59b) Protein (Q8I1F0) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila erecta (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MPSYMAFTPYIMFSTNYAAIAYILISRCYRDSMLLDLQRITLEVNREMLRTGKKMNSLIR RMFFLKTFTLTYSCLSYILAVLVYQWRAQNWSNLFNGLLVNISLTILVVTTFFYFVSLMH VARGFDFVNQQLEDIVSSQSMDLKKKAHELRSLWALHSNLSNTARRINKHYGPQMLALRF DYFIFSVINCCIGTIYSNSDQESSFEKFFGSLLYWARSVDFFLNDYICNLVTEYQSQPKF FAPEGSMTNELSSYLIYESSTRLDLLVCGLYPVNKAKWLEMVASIVVHSIMLFQFHLVMR GGYTTLFSRTYALLANIITLTMLPIVMWQVRSVFLAKRHYPQLILITNDIRYTVSFLIIL YTLLSRGFRDTALKEMQPLLLTLFREEKRCGYKGIDGVRRSLRILLFVKFFTLSWLCITD IIFLFYSSDAVIWVNIARFLFLSNTNNILEMVPMGYFLALWHIARGFDCVNRRLDQIVKS KSTRDQKELQHLWFLHTCLTKTALNINKIYAPQMLATRFDHFVIGVIQAYWGAVFTFDLS TSFLWVVYGSVQYHVRSLDYYLIDYMCDVAVEYHDSARHSWSEKECY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr59b |
Synonyms | Gr59b; Putative gustatory receptor 59b |
UniProt ID | Q8I1F0 |
◆ Recombinant Proteins | ||
G-397V | Recombinant Rabies Virus Glycoprotein Protein, His-tagged | +Inquiry |
ADORA1-254R | Recombinant Rhesus monkey ADORA1 Protein, His-tagged | +Inquiry |
Prkca-397X | Recombinant Xenopus Prkca, GST-tagged, Active | +Inquiry |
CA5A-8564H | Recombinant Human CA5A protein | +Inquiry |
TNFSF8-14H | Recombinant Human TNFSF8 Protein (K169A), His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST11-7228HCL | Recombinant Human CST11 293 Cell Lysate | +Inquiry |
H3F3C-5652HCL | Recombinant Human H3F3C 293 Cell Lysate | +Inquiry |
LOC554223-1019HCL | Recombinant Human LOC554223 cell lysate | +Inquiry |
FGFR2-2578HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
ZC3H12A-745HCL | Recombinant Human ZC3H12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr59b Products
Required fields are marked with *
My Review for All Gr59b Products
Required fields are marked with *
0
Inquiry Basket