Recombinant Full Length Drosophila Azteca Cytochrome C Oxidase Subunit 2(Mt:Coii) Protein, His-Tagged
Cat.No. : | RFL36874DF |
Product Overview : | Recombinant Full Length Drosophila azteca Cytochrome c oxidase subunit 2(mt:CoII) Protein (P84287) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila azteca (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELANDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mt:CoII |
Synonyms | mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P84287 |
◆ Recombinant Proteins | ||
RFL1417MF | Recombinant Full Length Mouse Mitochondrial Inner Membrane Protein Cox18(Cox18) Protein, His-Tagged | +Inquiry |
PTS-2067H | Recombinant Human PTS, GST-tagged | +Inquiry |
CARS-6566Z | Recombinant Zebrafish CARS | +Inquiry |
ZNF330-3017H | Recombinant Human Zinc Finger Protein 330, T7-tagged | +Inquiry |
GHR-1844R | Recombinant Rhesus macaque GHR protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
FLNA-170C | Active Native chicken FLNA | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
SLC12A7-597HCL | Recombinant Human SLC12A7 lysate | +Inquiry |
PIAS2-3204HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
COQ7-2006HCL | Recombinant Human COQ7 cell lysate | +Inquiry |
KIAA0391-4978HCL | Recombinant Human KIAA0391 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mt:CoII Products
Required fields are marked with *
My Review for All mt:CoII Products
Required fields are marked with *
0
Inquiry Basket