Recombinant Full Length Draba Nemorosa Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL10928DF |
Product Overview : | Recombinant Full Length Draba nemorosa Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (A4QL45) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Draba nemorosa (Woodland whitlowgrass) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPARLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQT VNPTWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSVSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFDTFPVVLVYGFGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY AIRAQLGEIFELDPATLKSYGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | A4QL45 |
◆ Recombinant Proteins | ||
RFL16409BF | Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yqed(Yqed) Protein, His-Tagged | +Inquiry |
SNAP25-296H | Recombinant Human SNAP-25 Protein, His tagged | +Inquiry |
Cr2-2729M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
Epha5-2814M | Recombinant Mouse Epha5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM2-5929R | Recombinant Rat TRIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
Lectin-1810M | Active Native Maclura Pomifera Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL26-5230HCL | Recombinant Human IL26 293 Cell Lysate | +Inquiry |
CWC27-7174HCL | Recombinant Human CWC27 293 Cell Lysate | +Inquiry |
LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
ROPN1-2251HCL | Recombinant Human ROPN1 293 Cell Lysate | +Inquiry |
ABHD4-675HCL | Recombinant Human ABHD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket