Recombinant Full Length Dog T-Cell Surface Glycoprotein Cd4(Cd4) Protein, His-Tagged
Cat.No. : | RFL1835CF |
Product Overview : | Recombinant Full Length Dog T-cell surface glycoprotein CD4(CD4) Protein (P33705) (25-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-463) |
Form : | Lyophilized powder |
AA Sequence : | VREVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWPKFLAITLGGILGLLLLIGLCVFCCVKCWRRRRQAERMSQIKRLLSEKKTCQCSHRIQKTCSLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD4 |
Synonyms | CD4; T-cell surface glycoprotein CD4; T-cell surface antigen T4/Leu-3; CD antigen CD4 |
UniProt ID | P33705 |
◆ Recombinant Proteins | ||
CD4-5643H | Recombinant Human CD4 protein, His-Avi-tagged | +Inquiry |
CD4-1075R | Active Recombinant Rat CD4 protein, His-tagged | +Inquiry |
CD4-017H | Active Recombinant Human CD4 protein (Lys26-Pro396), hFc-tagged, FITC-Labeled | +Inquiry |
CD4-5367H | Recombinant Human CD4 protein, His-tagged | +Inquiry |
CD4-4658H | Active Recombinant Human CD4 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD4-2580MCL | Recombinant Mouse CD4 cell lysate | +Inquiry |
CD4-1865FCL | Recombinant Ferret CD4 cell lysate | +Inquiry |
CD4-1905HCL | Recombinant Human CD4 cell lysate | +Inquiry |
CD4-947CCL | Recombinant Cynomolgus CD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD4 Products
Required fields are marked with *
My Review for All CD4 Products
Required fields are marked with *
0
Inquiry Basket