Recombinant Full Length Dog Peripherin-2(Prph2) Protein, His-Tagged
Cat.No. : | RFL8501CF |
Product Overview : | Recombinant Full Length Dog Peripherin-2(PRPH2) Protein (P52204) (1-346aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-346) |
Form : | Lyophilized powder |
AA Sequence : | MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIVMGVLSCVFNSLAGKICYDALDPAKYAKWKPWLKPYLAVCVLFNIALFLVTLCCF LMRGSLESTLAHGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFRCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT EELNLWVNGCRAALLSYYSSLMNSMGAVTLLVWLFEVTITIGLRYLHTALEGVSNPEDPE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRPH2 |
Synonyms | PRPH2; RDS; Peripherin-2; Retinal degeneration slow protein |
UniProt ID | P52204 |
◆ Recombinant Proteins | ||
Prph2-5151M | Recombinant Mouse Prph2 Protein, Myc/DDK-tagged | +Inquiry |
RFL14384MF | Recombinant Full Length Mouse Peripherin-2(Prph2) Protein, His-Tagged | +Inquiry |
PRPH2-18HFL | Recombinant Human PRPH2 Protein, Full Length, C-Flag tagged | +Inquiry |
RFL8501CF | Recombinant Full Length Dog Peripherin-2(Prph2) Protein, His-Tagged | +Inquiry |
RFL17207HF | Recombinant Full Length Human Peripherin-2(Prph2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPH2-2821HCL | Recombinant Human PRPH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPH2 Products
Required fields are marked with *
My Review for All PRPH2 Products
Required fields are marked with *
0
Inquiry Basket