Recombinant Full Length Dog Olfactory Receptor-Like Protein Olf2 Protein, His-Tagged
Cat.No. : | RFL438CF |
Product Overview : | Recombinant Full Length Dog Olfactory receptor-like protein OLF2 Protein (Q95155) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MDGKNCSSVNEFLLVGISNKPGVKVTLFITFLIVYLIILVANLGMIILIRMDSQLHTPMY FFLSHLSFSDARYSTAVGPRMLVGFIAKNKSIPFYSCAMQWLVFCTFVDSECLLLAVMAF DRYKAISHPLLYTVSMSSRVCSLLMAGVYLVGIMDASVNTILTFRLCFCESNVINHFFCD VPPLLLLSCSDTQVNELVIFTIFGFIELITLSGLFVSYCYIILAVRKINSAEGRFKAFST CTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKIISLFYSLVIPMLNPLIYSLRNKDVKEA LKKLKNKKWFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dog Olfactory receptor-like protein OLF2 |
Synonyms | Olfactory receptor-like protein OLF2 |
UniProt ID | Q95155 |
◆ Recombinant Proteins | ||
COMFC-0555B | Recombinant Bacillus subtilis COMFC protein, His-tagged | +Inquiry |
ITGB3BP-1967HFL | Recombinant Full Length Human ITGB3BP Protein, C-Flag-tagged | +Inquiry |
DLX1-281H | Recombinant Human DLX1 Protein, His-tagged | +Inquiry |
RASSF8B-10684Z | Recombinant Zebrafish RASSF8B | +Inquiry |
VP1-735H | Recombinant HAV Coat Protein VP1 Core Protein P2A | +Inquiry |
◆ Native Proteins | ||
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2C-592HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
SAE1-001HCL | Recombinant Human SAE1 cell lysate | +Inquiry |
ADH1C-9013HCL | Recombinant Human ADH1C 293 Cell Lysate | +Inquiry |
SCTR-1573HCL | Recombinant Human SCTR cell lysate | +Inquiry |
PCDHGB2-3388HCL | Recombinant Human PCDHGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Dog Olfactory receptor-like protein OLF2 Products
Required fields are marked with *
My Review for All Dog Olfactory receptor-like protein OLF2 Products
Required fields are marked with *
0
Inquiry Basket