Recombinant Full Length Didelphis Marsupialis Virginiana Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor(Pth1R) Protein, His-Tagged
Cat.No. : | RFL4228DF |
Product Overview : | Recombinant Full Length Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor(PTH1R) Protein (P25107) (27-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-585) |
Form : | Lyophilized powder |
AA Sequence : | DADDVITKEEQIILLRNAQAQCEQRLKEVLRVPELAESAKDWMSRSAKTKKEKPAEKLYS QAEESREVSDRSRLQDGFCLPEWDNIVCWPAGVPGKVVAVPCPDYIYDFNHKGRAYRRCD SNGSWELVPGNNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSISLGSLTVAVLIL GYFRRLHCTRNYIHMHLFVSFMLRAVSIFIKDAVLYSGVSTDEIERITEEELRAFTEPPP ADKAGFVGCRVAVTVFLYFLTTNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTLFGWGLP AVFVAVWVTVRATLANTECWDLSSGNKKWIIQVPILAAIVVNFILFINIIRVLATKLRET NAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGILWQVQMHYEMLFNSFQG FFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSTYSYGPMVSHTSVTNVGPRG GLALSLSPRLAPGAGASANGHHQLPGYVKHGSISENSLPSSGPEPGTKDDGYLNGSGLYE PMVGEQPPPLLEEERETVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTH1R |
Synonyms | PTH1R; PTHR; PTHR1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor |
UniProt ID | P25107 |
◆ Recombinant Proteins | ||
Stk31-6189M | Recombinant Mouse Stk31 Protein, Myc/DDK-tagged | +Inquiry |
RP9-3775R | Recombinant Rhesus Macaque RP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX21-2902H | Recombinant Human DDX21 protein, His-tagged | +Inquiry |
ATP2B1-11M | Recombinant Mouse ATP2B1 Protein, His-tagged | +Inquiry |
Histone H2AX-30130H | Recombinant Human Histone H2AX protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pear-702P | Pear Lysate, Total Protein | +Inquiry |
KHDRBS1-896HCL | Recombinant Human KHDRBS1 cell lysate | +Inquiry |
ARSG-132HCL | Recombinant Human ARSG cell lysate | +Inquiry |
RPA1-2243HCL | Recombinant Human RPA1 293 Cell Lysate | +Inquiry |
ESAM-2961HCL | Recombinant Human ESAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTH1R Products
Required fields are marked with *
My Review for All PTH1R Products
Required fields are marked with *
0
Inquiry Basket