Recombinant Full Length Dictyostelium Discoideum Uncharacterized Transmembrane Protein Ddb_G0287441(Ddb_G0287441) Protein, His-Tagged
Cat.No. : | RFL10609DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0287441(DDB_G0287441) Protein (Q54KH2) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MMDPYATTHRRLKQIQGHFMTPQSLRVLPQFTLNSLNNKSNISSMWRKLTTSSRIGAVSI PPLTAYYIFKLFKGKHRKFINDKDIEIIIKEISGNDIFDQVVKLASKVIGFLGVIQISNR METHLGVKLTFSKSYQLLVTLSSILDTILSFTKLTQKWGIIFCIVSILYCIINIRMLYLT LAHNKTVERLLSVTRTKCQGFKMNIPALGAWGSVVAITFYIWLKEAKKLAQSTGGILTMT AFLLSAIAAIRVGLRAAMTSFPGLTPFEGSSAVVIAIILGALPLIPYYTTSEWSRTLLSG YLSIVISMIINSFFAWKTPSML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0287441 |
Synonyms | DDB_G0287441; Uncharacterized transmembrane protein DDB_G0287441 |
UniProt ID | Q54KH2 |
◆ Recombinant Proteins | ||
PRKG1-26452TH | Recombinant Human PRKG1 | +Inquiry |
BTBD3-1662HF | Recombinant Full Length Human BTBD3 Protein, GST-tagged | +Inquiry |
MBL2-373H | Recombinant Human mannose-binding lectin (protein C) 2, soluble, His-tagged | +Inquiry |
NUDT22-10973M | Recombinant Mouse NUDT22 Protein | +Inquiry |
RFL26387IF | Recombinant Full Length Invertebrate Iridescent Virus 6 Uncharacterized Protein 234R(Iiv6-234R) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
HP-199M | Native Monkey Haptoglobin | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTSSA-8285HCL | Recombinant Human C14orf147 293 Cell Lysate | +Inquiry |
ACADM-9114HCL | Recombinant Human ACADM 293 Cell Lysate | +Inquiry |
CEP57-7572HCL | Recombinant Human CEP57 293 Cell Lysate | +Inquiry |
SMARCC2-1669HCL | Recombinant Human SMARCC2 293 Cell Lysate | +Inquiry |
ITM2C-5115HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0287441 Products
Required fields are marked with *
My Review for All DDB_G0287441 Products
Required fields are marked with *
0
Inquiry Basket