Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein Ddb_G0272716(Ddb_G0272716) Protein, His-Tagged
Cat.No. : | RFL24257DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Transmembrane protein DDB_G0272716(DDB_G0272716) Protein (Q86IJ0) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MENNNSLTIIKKADPKTKSNGEAFQIAFDSMDKIKTMLTQQNDKEKLVLKKLMIEMSINN SLLNELLTSFSTRVNIIDVEIIVLESQISTIERLTLENKKEIQSNDQEKIKEISSMIDKL IDPLLKNIDGLTNKFTEKNVNDEELKKKIDVFFENSKKLFQGIDKAEKSQFLTKFSSLFG VISGFLGIGSVTAIGATEAVGVTSLIAVGATSLSVVAPICAPVLLTFGCLVGAFISFYKQ SVARDKKLKTLKSLLSYYMENIELISQVTDETTKLIYHELKEKVLEFKKLEANLKIDFDL SPIKDQFKSITSKQNLIKDKVEEIANYQLDLIQECQKLKKKSLKNKTINKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0272716 |
Synonyms | DDB_G0272716; Transmembrane protein DDB_G0272716 |
UniProt ID | Q86IJ0 |
◆ Recombinant Proteins | ||
HEXIM2-2162HFL | Recombinant Full Length Human HEXIM2 Protein, C-Flag-tagged | +Inquiry |
Pgam2-1744M | Recombinant Mouse Pgam2 protein, His & T7-tagged | +Inquiry |
ZNF394-2642H | Recombinant Human ZNF394 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL13764MF | Recombinant Full Length Mouse Probable Palmitoyltransferase Zdhhc6(Zdhhc6) Protein, His-Tagged | +Inquiry |
LRRTM4-9318M | Recombinant Mouse LRRTM4 Protein | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYX1C1-6747HCL | Recombinant Human DYX1C1 293 Cell Lysate | +Inquiry |
RSG1-99HCL | Recombinant Human RSG1 lysate | +Inquiry |
STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
RPL32-2205HCL | Recombinant Human RPL32 293 Cell Lysate | +Inquiry |
NDUFB3-3906HCL | Recombinant Human NDUFB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0272716 Products
Required fields are marked with *
My Review for All DDB_G0272716 Products
Required fields are marked with *
0
Inquiry Basket