Recombinant Full Length Dictyostelium Discoideum Squalene Synthase(Fdft) Protein, His-Tagged
Cat.No. : | RFL6656DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Squalene synthase(fdfT) Protein (Q54DR1) (1-416aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-416) |
Form : | Lyophilized powder |
AA Sequence : | MQYMKSLAHPDEFLSLLKIGYTESFKPKSQLKENLGNKEWCYELLNKTSRSFAFVINELE PSLKDAICIFYLVLRGLDTIEDDTTVELNTKLPVLTSFSEGLYQPGYKVFGYGMNNDEKN LVENFDKVVDVFLGLGDGYCTIIHDITRRMANGMSEFLQKSVVTLPEWDLYCHYVAGLVG IGLSKIFHASGLESEWFATADDESNQMGLFLQKTNIIRDYLEDINEKRIFWPRDVWARYT LHLENFKEAKYQIPALHCLNDLITNALSHALIALDYMSRLKNPQVINFCAIPQVMAIGTL NACYNNYNVFTGVVKIRKGQRALIVDAIQSKGLTATYELFFKFANEMRHKVPPNDPSAKK TIQHLESIEKLCIEKLGYRPSGFNDFISYDWMAVTSLAVSSAFLIARHGPNFFSKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fdfT |
Synonyms | fdfT; DDB_G0292072; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | Q54DR1 |
◆ Recombinant Proteins | ||
VCX-113H | Recombinant Human VCX Protein, MYC/DDK-tagged | +Inquiry |
RFL20540BF | Recombinant Full Length Bacillus Cereus Stage Ii Sporulation Protein Sa(Spoiisa) Protein, His-Tagged | +Inquiry |
PGAM2-4060R | Recombinant Rat PGAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNM2-12H | Recombinant Human DNM2 Protein | +Inquiry |
ACE2-206R | Active Recombinant Rhesus monkey ACE2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM138-1002HCL | Recombinant Human TMEM138 293 Cell Lysate | +Inquiry |
SEC22C-1995HCL | Recombinant Human SEC22C 293 Cell Lysate | +Inquiry |
FBXO17-6307HCL | Recombinant Human FBXO17 293 Cell Lysate | +Inquiry |
THAP3-1772HCL | Recombinant Human THAP3 cell lysate | +Inquiry |
NKPD1-3816HCL | Recombinant Human NKPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fdfT Products
Required fields are marked with *
My Review for All fdfT Products
Required fields are marked with *
0
Inquiry Basket