Recombinant Full Length Dictyostelium Discoideum Putative Uncharacterized Transmembrane Protein Ddb_G0285347(Ddb_G0285347) Protein, His-Tagged
Cat.No. : | RFL31512DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0285347(DDB_G0285347) Protein (Q54NC9) (1-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-196) |
Form : | Lyophilized powder |
AA Sequence : | MTIKIRSEETCTESKFFYHNQDVTYNYHLDMVDNGINIWTSIHGKNAGLLPFVFQSFQIS SEEDAISFYKYVKLIGTGCYVAILISGNLPYHSKRITKAMKLVGGGSKSIETLSDSNPNF CLIGYKGQKIGSARQAIGDADIEEEGGISVWMMTTKNRCLFKNRILINLRNKTPLGTISQ LYKKHIKKEMTNNIYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0285347 |
Synonyms | DDB_G0285347; Putative uncharacterized transmembrane protein DDB_G0285347 |
UniProt ID | Q54NC9 |
◆ Recombinant Proteins | ||
FAS-12751H | Recombinant Human FAS, GST-tagged | +Inquiry |
GCNT3-3511M | Recombinant Mouse GCNT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSR1-1793H | Recombinant Human MSR1 Protein, His&GST-tagged | +Inquiry |
RC3H2-5443H | Recombinant Human RC3H2 Protein, GST-tagged | +Inquiry |
RFL4976DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 56 Homolog A(Tmem56A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GREM2-5752HCL | Recombinant Human GREM2 293 Cell Lysate | +Inquiry |
NKAPL-438HCL | Recombinant Human NKAPL lysate | +Inquiry |
DNAJB6-6884HCL | Recombinant Human DNAJB6 293 Cell Lysate | +Inquiry |
BAG3-56HCL | Recombinant Human BAG3 lysate | +Inquiry |
GAL3ST4-6045HCL | Recombinant Human GAL3ST4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0285347 Products
Required fields are marked with *
My Review for All DDB_G0285347 Products
Required fields are marked with *
0
Inquiry Basket