Recombinant Full Length Dictyostelium Discoideum Putative Uncharacterized Protein Ddb_G0292940(Ddb_G0292940) Protein, His-Tagged
Cat.No. : | RFL26168DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940(DDB_G0292940) Protein (Q54CM6) (1-72aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-72) |
Form : | Lyophilized powder |
AA Sequence : | MFIFFINTPTPPNIFFSKNIKIKKLMRFSCTEVCIFFSLIFFFFFFFFCVNWGCENNLLS RKYQMNRDTCNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0292940 |
Synonyms | DDB_G0292940; Putative uncharacterized protein DDB_G0292940 |
UniProt ID | Q54CM6 |
◆ Recombinant Proteins | ||
FAM131A-6447Z | Recombinant Zebrafish FAM131A | +Inquiry |
Cd79b-8776R | Recombinant Rat Cd79b protein(Met1-Asp158), His-tagged | +Inquiry |
Tnfrsf1b-447M | Recombinant Mouse Tnfrsf1b Protein, His-tagged | +Inquiry |
KLK7-894H | Active Recombinant Human KLK7 | +Inquiry |
DSTN-1622R | Recombinant Rat DSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
IBVT5399-230I | Native nfluenza (B/Tokio/53/99) IBVT5399 protein | +Inquiry |
GOT-185H | Active Native Human Glutamate Oxaloacetate Tranasminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNC5B-767RCL | Recombinant Rat UNC5B cell lysate | +Inquiry |
Ramos-023HCL | Human Ramos Whole Cell Lysate | +Inquiry |
SMAD1-1678HCL | Recombinant Human SMAD1 293 Cell Lysate | +Inquiry |
TNFRSF21-2977HCL | Recombinant Human TNFRSF21 cell lysate | +Inquiry |
IGFL3-5262HCL | Recombinant Human IGFL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0292940 Products
Required fields are marked with *
My Review for All DDB_G0292940 Products
Required fields are marked with *
0
Inquiry Basket