Recombinant Full Length Dictyostelium Discoideum Putative Uncharacterized Protein Ddb_G0274369(Ddb_G0274369) Protein, His-Tagged
Cat.No. : | RFL19131DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative uncharacterized protein DDB_G0274369(DDB_G0274369) Protein (Q86IV0) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MGLKIVDGSIVHDNLTSSSPPSVTNSSPLLNTKRRNSITSLSDYKKNKDTLNNSNNNINQ PFENSNNFNNNSKEIKNENKIKNFFQHLFSILLLKNPTMIQIIETLELSTNIYNIQFKLK YLLAICVSSQIIFKSSGLLITLLVLYLGTFFNKISINNKDKNKNNNTIDYSLKNNNIDTS LIKDINNSVISNNSSNSNNNNINNSNNNNNNNNRILSPNQLSKSSNVEYNKCKCKSPTTS SNNYLSSSQSRVQTLSSPNISPCNICVSPNLLYNSLSSLSSSLPINSCNYSMSEQEGDEF ESNFDFEDSQYEESDEEDNSSPAFHLYSSPNLRVACNKISTFSPNGRKLGTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0274369 |
Synonyms | DDB_G0274369; Putative uncharacterized protein DDB_G0274369 |
UniProt ID | Q86IV0 |
◆ Native Proteins | ||
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
MANEAL-4519HCL | Recombinant Human MANEAL 293 Cell Lysate | +Inquiry |
HCT15-021WCY | Human Colon Adenocarcinoma HCT15 Whole Cell Lysate | +Inquiry |
HENMT1-8151HCL | Recombinant Human C1orf59 293 Cell Lysate | +Inquiry |
ZCCHC7-200HCL | Recombinant Human ZCCHC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0274369 Products
Required fields are marked with *
My Review for All DDB_G0274369 Products
Required fields are marked with *
0
Inquiry Basket