Recombinant Full Length Dictyostelium Discoideum Protein Ei24 Homolog(Ddb_G0284253) Protein, His-Tagged
Cat.No. : | RFL28223DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Protein EI24 homolog(DDB_G0284253) Protein (Q54PW9) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | METFKEYVTKRIDNTIPQVKEMFKLIWLGVADSMKLKGAIIRTIKSEVLRKNFIHCIFLN GIIFLGTYLIYLYWVSPMLNYLLNHFPTLSNMFTIIYFSLWVYPVYIFSIIANSKWYTEI AKESFVISGRTTFANSTNGILSSFVDEIYRNLLFGVILVMSAIIAFIPYTNFINFVIITW LYSFWCFDYKWILRGKWNLLQRIQYFETHWAYMFGYGLIFTTCSFFFPMLIGNAIFSILY PLFIILSISAKPTKMVNQDGILPKQIPIFYVPEIIVNVILKLYVKYKNTRGAAKSTTPSP SPTTKQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0284253 |
Synonyms | DDB_G0284253; Protein EI24 homolog |
UniProt ID | Q54PW9 |
◆ Recombinant Proteins | ||
CP-9314Z | Recombinant Zebrafish CP | +Inquiry |
ALDH4A1-4755H | Recombinant Human ALDH4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AYP1020-RS10595-5948S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS10595 protein, His-tagged | +Inquiry |
RFL23661NF | Recombinant Full Length Nocardia Farcinica Protein Crcb Homolog 1(Crcb1) Protein, His-Tagged | +Inquiry |
GDF-9-4633C | Recombinant Chicken GDF-9 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-252H | Active Native Human Plasminogen | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
Collagen-45R | Native Rat Collagen I | +Inquiry |
FGA-78H | Active Native Human Fibrinogen (Pg & vWF depleted) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATS1-1529HCL | Recombinant Human SPATS1 293 Cell Lysate | +Inquiry |
TMEM204-970HCL | Recombinant Human TMEM204 293 Cell Lysate | +Inquiry |
ANKH-8861HCL | Recombinant Human ANKH 293 Cell Lysate | +Inquiry |
CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
COLEC10-001CCL | Recombinant Cynomolgus COLEC10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0284253 Products
Required fields are marked with *
My Review for All DDB_G0284253 Products
Required fields are marked with *
0
Inquiry Basket