Recombinant Full Length Dictyostelium Discoideum Probable Tetraspanin Tspa(Tspa) Protein, His-Tagged
Cat.No. : | RFL36401DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable tetraspanin tspA(tspA) Protein (Q55CV5) (1-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-235) |
Form : | Lyophilized powder |
AA Sequence : | MVDTSNLLPQTPRLLKVPLIILNIILWILGLVLVIVGGICVSFLSNFKDFTKASDAKSAL SNLTTSIPAGVLVIGILFVIFTVVGCFVAYKEKLVGLVIYCAVMLILLVILIGVGGKAIT LHNDDIINEVGGAWEHVANGTKNSTLTRLENFLKCCKWSNVSIDSSDLCPKDGDKIKYEG HYCGEALSDQFSSKIYAVGAAGLAIGIIELVAILFSLFLIIRICRSPRTRSYDQY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tspA |
Synonyms | tspA; cdp9; DDB_G0269110; Probable tetraspanin tspA |
UniProt ID | Q55CV5 |
◆ Native Proteins | ||
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
CFH-115H | Active Native Human Factor H | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCS2-804HCL | Recombinant Human HMGCS2 cell lysate | +Inquiry |
HNRNPH3-5444HCL | Recombinant Human HNRNPH3 293 Cell Lysate | +Inquiry |
THRSP-1087HCL | Recombinant Human THRSP 293 Cell Lysate | +Inquiry |
WWC1-275HCL | Recombinant Human WWC1 293 Cell Lysate | +Inquiry |
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tspA Products
Required fields are marked with *
My Review for All tspA Products
Required fields are marked with *
0
Inquiry Basket