Recombinant Full Length Dictyostelium Discoideum Probable Phosphatidate Cytidylyltransferase(Cdsa) Protein, His-Tagged
Cat.No. : | RFL15542DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable phosphatidate cytidylyltransferase(cdsA) Protein (Q55D90) (1-479aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-479) |
Form : | Lyophilized powder |
AA Sequence : | MRTDNIRNRKEQLKKQEKKDFDSSKDEETSTSDEEESSGGNRSKIAGKENHQNKNIINQK TNNNNNNNNIKEKDIIDSSVNNADNLKATDPPSAKYKKLAIRSVMGAFMIGFFTIVLSTD HFIVALFVIALQLLVFKEMIALRYIEAKEKKIPHFRTLNWFFLFTSFFFFYAKPILITLA NYYPDIFQHFVRYHLWHSFSLYCIGFVLFILTLRKGVYRYQFSQLTWTLMILMMVVVQSN FLISNIYQGLIWFILPVSIIVCNDIFAYFNGFFLGKKFINRPLMKISPNKTWEGFIGATG WTLLFAYYFCGFLLKYDWIVCPKGNTGFMESLHCTRDPVFLEKEFIFPPEITTIAFKYLG ITLLPFTYIPIQFHALVLALFGSLIAPFGGFFASGIKRAYKVKDFDTIFPGHGGVTDRTD CQFIMGLFIHVYYNTFIKTLEIDPTFIWQNIMMLSMEEKMVIYEKLKQSIEFTTGTITA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdsA |
Synonyms | cdsA; DDB_G0269742; Probable phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase |
UniProt ID | Q55D90 |
◆ Recombinant Proteins | ||
PDCD1-188HAF488 | Recombinant Human PDCD1 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
RFL24257DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein Ddb_G0272716(Ddb_G0272716) Protein, His-Tagged | +Inquiry |
MME-392H | Recombinant Human MME Protein, Fc-tagged | +Inquiry |
ERBB4-26848TH | Recombinant Human ERBB4 | +Inquiry |
PPFIBP2-13177M | Recombinant Mouse PPFIBP2 Protein | +Inquiry |
◆ Native Proteins | ||
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-749B | Bovine Brain Membrane Lysate, Total Protein | +Inquiry |
CHST8-7505HCL | Recombinant Human CHST8 293 Cell Lysate | +Inquiry |
HOXB1-810HCL | Recombinant Human HOXB1 cell lysate | +Inquiry |
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
TUFT1-640HCL | Recombinant Human TUFT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdsA Products
Required fields are marked with *
My Review for All cdsA Products
Required fields are marked with *
0
Inquiry Basket