Recombinant Full Length Dictyostelium Discoideum Probable Mitochondrial Chaperone Bcs1-B(Bcsl1B) Protein, His-Tagged
Cat.No. : | RFL16493DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable mitochondrial chaperone BCS1-B(bcsl1b) Protein (Q54DY9) (1-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-458) |
Form : | Lyophilized powder |
AA Sequence : | MENVITNNNKGLPKSILKFIPEPIQPLFENPFFSAGFGLIGVGSILAMGRKGFQQAMIQS RRYFFVSVEVPSKDKSFHWLMEWLATKKNKNTRHVSVETTFHQHESGDIVSRINFVPSVG THYVFYRGRVIKVERSREKNVIDMNSGNLWESITLTTLGTGRQVFQNLIEEAKEMALEKE EGKTLIYTSMGTDWRRFGHPRRKRPISSVILDKGKSELIIQDVKKFLNNSDWYNDRGIPY RRGYLLYGPPGTGKSSFITALAGELQLSICILNLAGKSVSDTSLNQLLATAPQRSIILLE DIDSAIQTGNHDLSAKSNSANAPSISSGGLQYQGYYGNPSVSSGGSALTFSGLLNALDGV AASEGRILFMTTNHLEKLDKVLIRPGRVDLQIEIGLCSSYQMEQMFLKFYPTDFDLAKQF VEKLENYKFSPAQLQAYFMTYSNNSIEAINNLNELIKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bcsl1b |
Synonyms | bcsl1b; DDB_G0291910; Probable mitochondrial chaperone BCS1-B; BCS1-like protein 2 |
UniProt ID | Q54DY9 |
◆ Recombinant Proteins | ||
NKX2-3-301372H | Recombinant Human NKX2-3 protein, GST-tagged | +Inquiry |
OSMR-542H | Active Recombinant Human OSMR | +Inquiry |
PTGS2-2640H | Recombinant Human PTGS2 Protein, His-tagged | +Inquiry |
CST8-667H | Recombinant Human CST8 Protein, Fc-tagged | +Inquiry |
CD40LG-785H | Recombinant Human CD40LG protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-154R | Native Rabbit Immunoglobulin G | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
PTTG1IP-1444HCL | Recombinant Human PTTG1IP cell lysate | +Inquiry |
CHI3L2-2020HCL | Recombinant Human CHI3L2 cell lysate | +Inquiry |
MASP2-4459HCL | Recombinant Human MASP2 293 Cell Lysate | +Inquiry |
OR3A4P-1253HCL | Recombinant Human OR3A4P cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bcsl1b Products
Required fields are marked with *
My Review for All bcsl1b Products
Required fields are marked with *
0
Inquiry Basket