Recombinant Full Length Dictyostelium Discoideum Probable Delta(5) Fatty Acid Desaturase C(Ddb_G0294553) Protein, His-Tagged
Cat.No. : | RFL29823DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable Delta(5) fatty acid desaturase C(DDB_G0294553) Protein (Q1ZXQ5) (1-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-459) |
Form : | Lyophilized powder |
AA Sequence : | MENEKKLFKKLYSWKEISKHNTIENGIWISIDGLVYDITKFIKHHPGGEQVLILAAGRDV TNLFESYHPMTDLPSKMLKQYEIGQVSTMEFPKYVEKSKFYSTLKERVREHFKKSNKDPK FAFGIIARLIFVYWFLITSYYVSHYAFIENFYLNCLLAIVYSLSNSLFSLHMMHDACHSA ISHNPKVWKWLGATYDLFIGASFFYWCNQHVIGHHVYTNIRNADPDIGDSEVDFRIVTPY QNKYWIYKYQHIYAPFLYGLYSIKYRLCDYSVFTEGSIGRVRTANASNFEIISFIIGKLV FIVFRFIIPLQYHSLVNLLTYFFIAEFFFGLYLSFGFQVSHSADNLKIVATSVNENDEPT NVDEDWAIHQIKTTQDYGINSYMCLFFSGGVNLQVVHHLFPSISQEYYGELVPIIKKVCD EYDVHYNIQPTFYAAFKSHIDFLYNMGNNENYVRKSVTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0294553 |
Synonyms | DDB_G0294553; Probable Delta(5 fatty acid desaturase C; Delta-5 fatty acid desaturase C |
UniProt ID | Q1ZXQ5 |
◆ Recombinant Proteins | ||
IFNAR1-4424H | Recombinant Human IFNAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLIC5A-1771Z | Recombinant Zebrafish CLIC5A | +Inquiry |
PRDX2-4027H | Recombinant Human PRDX2 protein, His-tagged | +Inquiry |
RFL11898PF | Recombinant Full Length Pongo Abelii C-C Chemokine Receptor Type 5(Ccr5) Protein, His-Tagged | +Inquiry |
INS1-4560M | Recombinant Mouse INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17RB-549HCL | Recombinant Human IL17RB cell lysate | +Inquiry |
UPP2-493HCL | Recombinant Human UPP2 293 Cell Lysate | +Inquiry |
E4F1-522HCL | Recombinant Human E4F1 cell lysate | +Inquiry |
Ventricle-231H | Human Heart: Ventricle (LT) Membrane Lysate | +Inquiry |
RFPL1-2406HCL | Recombinant Human RFPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0294553 Products
Required fields are marked with *
My Review for All DDB_G0294553 Products
Required fields are marked with *
0
Inquiry Basket