Recombinant Full Length Dictyostelium Discoideum Mitochondrial Substrate Carrier Family Protein H(Mcfh) Protein, His-Tagged
Cat.No. : | RFL35204DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Mitochondrial substrate carrier family protein H(mcfH) Protein (Q552L9) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MLSNSVNNNNNNNNINNSNSNNNDSNIHKNVKKLMVASIFGGIMSSLIVTPLDVVKTRLQ TQNTGSHINQKHVFKGTLDAFKKIYKNEGPLTFWRGVTPSLLMTIPSATIYFTSYEYLKE YLYQFNDTEAYNIYTVPLVAGTLARIFSASVTSPFELLRTNSQGIVLQNAYKNTVAMAAS SSTATIGTIPLSSEQRFNSFKLYRDIVNNVGIKGLWRGLGPTLVRDVPFSAIYWAGYEVL KNKLMKSQIDPNFSRNSKSPFFINFIAGATSGTLAAVLTTPIDVIKTRIQMSAQQTLSPS LTPQQQLDFIKKNNSSIYHLKQILSQEGWKGLTKGLVPRVAKVSPACAIMISTFEYIKQS HIADDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcfH |
Synonyms | mcfH; slc25a40; DDB_G0275985; Mitochondrial substrate carrier family protein H; Solute carrier family 25 member 40 homolog |
UniProt ID | Q552L9 |
◆ Recombinant Proteins | ||
RFL22725DF | Recombinant Full Length Danio Rerio Wsc Domain-Containing Protein 2(Wscd2) Protein, His-Tagged | +Inquiry |
RAB32A-11479Z | Recombinant Zebrafish RAB32A | +Inquiry |
LRRC37B-5961HF | Recombinant Full Length Human LRRC37B Protein | +Inquiry |
PRKG1-158HFL | Active Recombinant Full Length Human PRKG1 Protein, N-His-tagged | +Inquiry |
ACYP2-1270M | Recombinant Mouse ACYP2 Protein | +Inquiry |
◆ Native Proteins | ||
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
LDL-405H | Native Human Low Density Lipoprotein, Acetylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLITRK4-1719HCL | Recombinant Human SLITRK4 cell lysate | +Inquiry |
GPN1-1934HCL | Recombinant Human GPN1 cell lysate | +Inquiry |
CFH-2409HCL | Recombinant Human CFH cell lysate | +Inquiry |
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
IL17C-5243HCL | Recombinant Human IL17C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mcfH Products
Required fields are marked with *
My Review for All mcfH Products
Required fields are marked with *
0
Inquiry Basket