Recombinant Full Length Dictyostelium Discoideum Mitochondrial Substrate Carrier Family Protein C(Mcfc) Protein, His-Tagged
Cat.No. : | RFL497DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Mitochondrial substrate carrier family protein C(mcfC) Protein (B0G159) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MVLNENDKEFVKKLFDSLDKDNNGKLTREEIKEGFFKLRIPSSEKDIESFLTNVDKDKDG SVSFKEFEDFTIENIKKLKIVFEELDTNKSGTLDIHEIEESIKKLNIPLYSEQELIRLFH RIDKNRDNQIDFNEWRELLVLLPNSNLQLIISFWKDSQILDAGFDNGGFIPPMVEKKEKA SSLRNTITYMLAGSVAGFASRTSTAPLERVKIMCQLNHGKPISLISAFKACYKDGGIKGF FRGNLANIIKVSPESAVKFGTYEYVKKLFAENDCELTSAQRFISGSVAGVVSHTTLFPLE VVRLRLSAEIAGTYNGIFDCFKKIAISEKSIRPFYRGLGASITATIPHSGVNMMVYEFLK HKVIKMTGNEFPTAGQLLVCASTSSVCGQLVGYPFHVVKSRLITQGSSVNQEKYTGLFDG LTKIIKKEGPIGLYKGIVPSFMKSIPSHSITFIVYEGFKKAFDVNLKEKKHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcfC |
Synonyms | mcfC; CBP11; DDB_G0287009; Mitochondrial substrate carrier family protein C |
UniProt ID | B0G159 |
◆ Recombinant Proteins | ||
RFL18856EF | Recombinant Full Length Escherichia Coli Lipid A Biosynthesis Myristoyltransferase(Lpxm) Protein, His-Tagged | +Inquiry |
RAD51D-5049H | Recombinant Human RAD51D, His-tagged | +Inquiry |
DNAJB5-12066H | Recombinant Human DNAJB5, His-tagged | +Inquiry |
DAPK3-4921HF | Active Recombinant Full Length Human DAPK3 Protein, DDK-tagged, Biotinylated | +Inquiry |
NTF3-16H | Recombinant Human NTF3, StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-33R | Native Rat Carbonic Anhydrase II (CA2) Protein | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
ATXN7L3-53HCL | Recombinant Human ATXN7L3 lysate | +Inquiry |
SEMA6A-2081HCL | Recombinant Human SEMA6A cell lysate | +Inquiry |
CRYBA4-7263HCL | Recombinant Human CRYBA4 293 Cell Lysate | +Inquiry |
SH2D1B-1597HCL | Recombinant Human SH2D1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mcfC Products
Required fields are marked with *
My Review for All mcfC Products
Required fields are marked with *
0
Inquiry Basket