Recombinant Full Length Dictyostelium Discoideum Mitochondrial Substrate Carrier Family Protein B(Mcfb) Protein, His-Tagged
Cat.No. : | RFL14138DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Mitochondrial substrate carrier family protein B(mcfB) Protein (Q54MZ4) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MSNNNNNNNNNNNNNNNNNNNNNNNNNNDKNNNNNIDSSIKEKKLKEWFDKFDVDKDGSL DSNELKKGFKLHANIDMKDEQITKMMERADSNKNHRIEWDEFLKVASDSSSPEIEDIAEH WLQYSTKPIVHAPADVPSWKLLLSGGVAGAVSRTCTSPLERLKILNQVGHMNLEQNAPKY KGRGIIQSLKTMYTTEGFIGFFKGNGTNVIRIAPYSAIQFLSYEKYKNFLLNNNDQTHLT TYENLFVGGAAGVTSLLCTYPLDLIRSRLTVQVFGNKYNGIADTCKMIIREEGVAGLYKG LFASALGVAPYVAINFTTYENLKKTFIPKDTTPTVVQSLTFGAISGATAQTLTYPIDLIR RRLQVQGIGGKDILYNGTFDAFRKIIRDEGVLGLYNGMIPCYLKVIPAISISFCVYEVMK KILKIDSKKISYQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcfB |
Synonyms | mcfB; DDB_G0285599; Mitochondrial substrate carrier family protein B |
UniProt ID | Q54MZ4 |
◆ Recombinant Proteins | ||
DEDD-750Z | Recombinant Zebrafish DEDD | +Inquiry |
Cxcl10-39M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 10 | +Inquiry |
CCL11-08H | Recombinant Human CCL11 Protein | +Inquiry |
SNX24-8551M | Recombinant Mouse SNX24 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF12-2460H | Recombinant Human TAF12 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
◆ Cell & Tissue Lysates | ||
Uterus-Corpus-556H | Human Uterus-Corpus Membrane Lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
UBOX5-548HCL | Recombinant Human UBOX5 293 Cell Lysate | +Inquiry |
DUSP3-001HCL | Recombinant Human DUSP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mcfB Products
Required fields are marked with *
My Review for All mcfB Products
Required fields are marked with *
0
Inquiry Basket