Recombinant Full Length Dictyostelium Discoideum Metabotropic Glutamate Receptor-Like Protein D(Grld) Protein, His-Tagged
Cat.No. : | RFL13831DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Metabotropic glutamate receptor-like protein D(grlD) Protein (Q54L53) (23-791aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-791) |
Form : | Lyophilized powder |
AA Sequence : | EPEKKFKLITLLAAHVQDLGFNNMVNRGHVEVSKAMKLEDSQAIVVVGYNDTIRILAPLV AVGDVDLVICSSQDHAQACRELATKYKGSSIKTQFLVRGSGEATSNLITYSYNYANANYI SGYFAGLYTKTNKIGFLSPGAIDNNNDSFVYAFWYGAKRANPDISFYYYNIGNYLNPDKT VAATKDLLDMGCDMVADTLNDFSTGNTLIANNRKTAMGTSGFPQRDVYGEDVIYSYNYNW FKLFYPVAQSVYSGNTNNTNWYADFNLNETISFFGLSFSFTVPNETLTKFYEELDYLKRT PRLSHPYFCNDLMYEYAKKNHLTMSTNDSTHCLANSQFTRINAPFPGMTWLGNYEITLTE VYQSRPIQIAISSISSFFIVTVLVMMGLVVRFRKNPSIRSASPIFLNFILFGALIIYVGI IIWSSSINSASCNAQFWLVTLGFTTLIGSLVVKNVRIWLIFDNPELKLVKITNLQLVPWV GVCLVINIILMSILTSVGDLREVNAQGIDSLGKYEFMRICKMNSSGASTLYTILAYFAAL LLIGVFVSWKIRIVDILEFNESKAIANTLYAISFCLFVIVPLMISPQDKQSEKIILCIAG LFIVTAAVLIIFVPKFYRVYIFGSGGTSDMFYKKKKQSPVATARAESTSKGSSGGGAGSG GATGGSGVKTNKRGNLVSGDFSDDTESSLSEPNKPVKVVAGAVLAEFTDDTISDLDNIDQ PIEIITENGQDSNNNNNNEENKDNNIENNKISEEIKENLKNEENNDGDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | grlD |
Synonyms | grlD; DDB_G0286895; Metabotropic glutamate receptor-like protein D |
UniProt ID | Q54L53 |
◆ Recombinant Proteins | ||
Ctns-2363M | Recombinant Mouse Ctns Protein, Myc/DDK-tagged | +Inquiry |
TNFAIP6-3315H | Recombinant Human TNFAIP6, His-tagged | +Inquiry |
CYTH2-2169M | Recombinant Mouse CYTH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12701CF | Recombinant Full Length Chlamydia Trachomatis Serovar B Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged | +Inquiry |
FSD1L-2551H | Recombinant Human FSD1L Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIC4-9099HCL | Recombinant Human ACCN4 293 Cell Lysate | +Inquiry |
PBL-01HCL | Human Peripheral blood leukocyte lysate | +Inquiry |
KLF2-4928HCL | Recombinant Human KLF2 293 Cell Lysate | +Inquiry |
CSF2RA-2713HCL | Recombinant Human CSF2RA cell lysate | +Inquiry |
WNT5B-292HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All grlD Products
Required fields are marked with *
My Review for All grlD Products
Required fields are marked with *
0
Inquiry Basket