Recombinant Full Length Chlamydia Trachomatis Serovar B Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL12701CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1(cdu1) Protein (C4PQR0) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSISKTAPVPPQDSSKPVLISEEPQNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSTPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRRIIEALVPAWD SDIIFKCLCYFHTLYPGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLQGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMKKDLQSFAQQLDQVYPAYDSQIFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; JALI_8791; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | C4PQR0 |
◆ Recombinant Proteins | ||
TRMT6-3517Z | Recombinant Zebrafish TRMT6 | +Inquiry |
GAPDHS-3010H | Recombinant Human GAPDHS Protein, His (Fc)-Avi-tagged | +Inquiry |
CALCOCO2-174H | Recombinant Human calcium binding and coiled-coil domain 2 Protein, Tag Free | +Inquiry |
PGRMC2-12328Z | Recombinant Zebrafish PGRMC2 | +Inquiry |
ALKBH7-1559M | Recombinant Mouse ALKBH7 Protein | +Inquiry |
◆ Native Proteins | ||
IBV-06I | Native Influenza B Antigen | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CER1-338HCL | Recombinant Human CER1 cell lysate | +Inquiry |
C11orf84-8332HCL | Recombinant Human C11orf84 293 Cell Lysate | +Inquiry |
POSTN-2269MCL | Recombinant Mouse POSTN cell lysate | +Inquiry |
ZMAT3-157HCL | Recombinant Human ZMAT3 293 Cell Lysate | +Inquiry |
FBXO46-274HCL | Recombinant Human FBXO46 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket