Recombinant Full Length Dictyostelium Discoideum Frizzled/Smoothened-Like Sans Crd Protein G(Fscg) Protein, His-Tagged
Cat.No. : | RFL8338DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein G(fscG) Protein (Q54DR6) (25-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-453) |
Form : | Lyophilized powder |
AA Sequence : | QSLPSLPSPTIYKSSQCRGDLVYRNVSNRMEDEKIGFTFVQYNGTYQSCVIPCPSPFFTL DEWNKFLYMSLVMGTISFLCGLFLLITYSPIVNKTHNRHTIGVMCMSFGVCLAMCSDMWN FGSNFTDQKSICPSPGQYLTTSNSRCLGSGIVLQFGGVFGFLNWTLLSFDLFMNIKGIIT KNYDKYYFVATFIIAIIFTFVPIVNDQYSMSYIGLGCWLGSAVYQLIFFWILLSICLIVS SVFIILILKEIYIIIKQSKQKTSLKGNIRPLLCITVTSFAFFYMFFYYISIVIEGDYYER ILNEYTDCLMDPTKDVSECKFPRMSVANEFVFLLCLRLLGIGAFIFYGINKEVKKIWLNS FWFNNSFVGKYIGSKRSMGNDITNSYASKAYSKNYNNNNSINSYNSGLELSIIDMSCNKD DNFKPIIIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fscG |
Synonyms | fscG; DDB_G0292156; Frizzled/smoothened-like sans CRD protein G |
UniProt ID | Q54DR6 |
◆ Recombinant Proteins | ||
PIK3CD-1989C | Recombinant Chicken PIK3CD | +Inquiry |
Gp1bb-5729M | Recombinant Mouse Gp1bb protein, His & T7-tagged | +Inquiry |
Lgals1-7256M | Recombinant Mouse Lgals1 Protein, His-tagged | +Inquiry |
FOXP3-50H | Recombinant Human FOXP3, MYC/DDK-tagged | +Inquiry |
Ptprb-5244M | Recombinant Mouse Ptprb Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMF2-1345HCL | Recombinant Human SUMF2 293 Cell Lysate | +Inquiry |
VIPAS39-407HCL | Recombinant Human VIPAR 293 Cell Lysate | +Inquiry |
NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
ZNF558-52HCL | Recombinant Human ZNF558 293 Cell Lysate | +Inquiry |
PTBP3-1532HCL | Recombinant Human PTBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fscG Products
Required fields are marked with *
My Review for All fscG Products
Required fields are marked with *
0
Inquiry Basket