Recombinant Full Length Dictyostelium Discoideum Frizzled/Smoothened-Like Sans Crd Protein A(Fsca) Protein, His-Tagged
Cat.No. : | RFL26898DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein A(fscA) Protein (Q54H37) (23-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-549) |
Form : | Lyophilized powder |
AA Sequence : | KENKILEIYKSGNICPYPLHYRERTGSDDHDFDLGFVYARNDSNCLLPCPSPIYTSQEVN TLSLMIKITGTISFIASLILLLIYSPLINRMGYNRHTIGIFFLTFSVFLIMLTDIIYVHH GNDLICPQSHRYSRQNDSGCTITGILFQYGCIAAVLFWATLSLDLYLTLKKISTKKVEKW YLIILTLIALILTFVPLVKKSYGYLVTGLACWILDSTDQIIFFWAPFTAILGIGSILIVL VVYEIYKISKITKQNRGIFQSHIRPLLMVLFIFGQFLFILAFNALINNKYDEYSARMDSY IDCLFSSSSYSYLCRLKTFPFEMEFIVLFFLRLIGIEVLIFYGFTQQTKKILLHSFLVNN IFFKKYFIRLDGASLDFSTVDEELKVVNFSCNNNNNNNNSNSNSNSNLNNNLNNNLNNNN LNNNNNLNNLNNLNINNNLKNSQNNLNNSQQNEPLSSQKLSENGNVNVFMVESFDNNNSM INQFKHLEEKNNIILNSIISPVQEEQYEEDEINNKNINNNSNNDENN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fscA |
Synonyms | fscA; DDB_G0289725; Frizzled/smoothened-like sans CRD protein A |
UniProt ID | Q54H37 |
◆ Recombinant Proteins | ||
VEGFC-567H | Recombinant Human VEGFC Protein, His-tagged | +Inquiry |
GM10486-6473M | Recombinant Mouse GM10486 Protein | +Inquiry |
C16orf62-301279H | Recombinant Human C16orf62 protein, GST-tagged | +Inquiry |
POU3F2-6953M | Recombinant Mouse POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF180-14322M | Recombinant Mouse RNF180 Protein | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS15-559HCL | Recombinant Human RPS15 lysate | +Inquiry |
SERBP1-1949HCL | Recombinant Human SERBP1 293 Cell Lysate | +Inquiry |
HSD11B1L-5379HCL | Recombinant Human HSD11B1L 293 Cell Lysate | +Inquiry |
PFTK1-1337HCL | Recombinant Human PFTK1 cell lysate | +Inquiry |
COL4A3-1219RCL | Recombinant Rat COL4A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fscA Products
Required fields are marked with *
My Review for All fscA Products
Required fields are marked with *
0
Inquiry Basket