Recombinant Full Length Dictyostelium Discoideum Frizzled And Smoothened-Like Protein B(Fslb) Protein, His-Tagged
Cat.No. : | RFL19339DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled and smoothened-like protein B(fslB) Protein (Q55CD6) (27-642aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-642) |
Form : | Lyophilized powder |
AA Sequence : | NNNIKTFGLNLPDGYGAGLVDPTATCSNYIGDSIDQPLCNEKLPNYKNIYTSKNITIQYI NQKIVEKTFISLTFLQSKCFDLNFAEFGICDIYFPPCFQTPTTITPIKSVSLPQRLCKSA CERMVSNCSSLGASLNCSDPLKFPRIATLYNLTDYGFTANGGFFPVPCSDPLATFENKST TSELIEICPSPLLLFNSSDPKYSADRGYTYLTPTNCVLPCVAPIYTEKKWHQMYNMSKIL STISFVCSIYNVLTFGILNHRRSKYNYCITFFSASVIIITMMDIVTYGIGYEKLLCPEPG RFAVQSDVSCGATGALFHIGITNGVFWWTTMSICLFAVVKRIKLFDFRYFIIFNTTASLI SVIIPLAGNAFMAGTGSLACWIRKTWYVNSVFWIPCGIALTIGSVCIILVIYEIYKITKN VSTKDNRMILLQIKPFLCVTLVGGSFYYLFIFNFDNESHSKEYKEKVVDYVMCLLSDTGK ECLMAGPNYVAYFVFYFFIRLFGITFFCIYGTSQNARDIWIHSKILNHPNIKPFLLKYNI INFNSMTHYGSGTNPTSNSKNSKNNQNNQNNNSRKEFESKNIELEVNESISKGQTTRGAD DEEESNINSASNTSSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fslB |
Synonyms | fslB; DDB_G0270730; Frizzled and smoothened-like protein B |
UniProt ID | Q55CD6 |
◆ Recombinant Proteins | ||
ZC3H10-11825Z | Recombinant Zebrafish ZC3H10 | +Inquiry |
NPS-4052R | Recombinant Rat NPS Protein | +Inquiry |
EDC3-12276H | Recombinant Human EDC3, GST-tagged | +Inquiry |
TLR9-0930H | Recombinant Human TLR9 Protein (Asn64-Glu189), N-His tagged | +Inquiry |
CYP11A1-11761H | Recombinant Human CYP11A1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-232P | Native Porcine Mucin | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD248-315HCL | Recombinant Human CD248 cell lysate | +Inquiry |
ZNF137P-1988HCL | Recombinant Human ZNF137P cell lysate | +Inquiry |
RNF111-1516HCL | Recombinant Human RNF111 cell lysate | +Inquiry |
GMPPA-5879HCL | Recombinant Human GMPPA 293 Cell Lysate | +Inquiry |
APRT-102HCL | Recombinant Human APRT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fslB Products
Required fields are marked with *
My Review for All fslB Products
Required fields are marked with *
0
Inquiry Basket