Recombinant Full Length Dictyostelium Discoideum Er Lumen Protein Retaining Receptor(Kdelr) Protein, His-Tagged
Cat.No. : | RFL19662DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum ER lumen protein retaining receptor(kdelr) Protein (Q86JE5) (1-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-218) |
Form : | Lyophilized powder |
AA Sequence : | MNLFSFLGDMLHLGSMLILLFKIKNDKSCAGVSLKSQILFTIVFTARYLDLFTNYVSLYI TFMKITYIAVSYYTLHLIARKYKFTYDKDHDTFKIVYLIASCAILSLITYDKTTIGIYST FLEILWTFSIYLESIAILPQLILLQRTGEVEALTSNYIVLLGGYRAFYLFNWIYRITFYN WSGKIEMLSGLLQTILYADFFYYYAKSRMYGKKLVLPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdelr |
Synonyms | kdelr; erd2; DDB_G0272124; ER lumen protein-retaining receptor |
UniProt ID | Q86JE5 |
◆ Recombinant Proteins | ||
IL22-2926Z | Recombinant Zebrafish IL22 | +Inquiry |
C-1809J | Recombinant JEV C Protein | +Inquiry |
TTC33-17565M | Recombinant Mouse TTC33 Protein | +Inquiry |
RARA-6105C | Recombinant Chicken RARA | +Inquiry |
LOC101254439-5412T | Recombinant Tomato LOC101254439 Protein (Glu42-Asn518), N-His tagged | +Inquiry |
◆ Native Proteins | ||
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
RB5200-3281H | Native Human RB5200 | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL1-1657HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
GHITM-5942HCL | Recombinant Human GHITM 293 Cell Lysate | +Inquiry |
MT1A-4104HCL | Recombinant Human MT1A 293 Cell Lysate | +Inquiry |
RTDR1-2125HCL | Recombinant Human RTDR1 293 Cell Lysate | +Inquiry |
Heart-856R | Mini Rabbit Heart Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdelr Products
Required fields are marked with *
My Review for All kdelr Products
Required fields are marked with *
0
Inquiry Basket