Recombinant Full Length Dictyostelium Discoideum Delta(14)-Sterol Reductase(Erg24) Protein, His-Tagged
Cat.No. : | RFL25489DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Delta(14)-sterol reductase(erg24) Protein (Q54PP1) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MSAVRNRNNVEKQSNNGAQLTEVQKKELADLQKVHPANEFGGIIGTFLLTFILPVVVYWI WASIEFNNGYLLRPETLSVEGVKAFLAQLYHYVITYAYPTKEAAIIYFSWFGFQAFLQHV VPGRKVLGSPLPGGARLEYTLNGWASWWITLIVIPIAIYFGLFKATILIDNYAPMMTVVN IWSFVFTFLLKIHAKLKGEEERMSGHFFYDFWMGFARNPRIGSFDLKLFCEARPGLILWV LMNFSIAAKQLEVYGEISLSVILVCCFHFWYIADYYYHEEAILTTMDIITEKFGYMLVYG DLSWVPFTYCFQCYYLYKHLVNGAPLHISIGYAIFVVSLKCFGFYLFRWVNSQKHDFRRN PEAPVWGKPAEFILTKRGTKLLCSGFWGICRHLNYTGDIILSWAWCLPCQFDSLAPYFYG IYFTSLDLHRCWRDHNACLVKYGDDWRAYCKRVPYNFIPGLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | erg24 |
Synonyms | erg24; DDB_G0284407; Delta(14-sterol reductase; C-14 sterol reductase; Sterol C14-reductase |
UniProt ID | Q54PP1 |
◆ Recombinant Proteins | ||
CDH20-0808H | Recombinant Human CDH20 Protein (Trp61-Phe274), His tagged | +Inquiry |
NUP205-3701H | Recombinant Human NUP205 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF7-897H | Recombinant Human IRF7 Protein, Myc/DDK-tagged | +Inquiry |
AHI1-459H | Recombinant Human AHI1 Protein, GST-tagged | +Inquiry |
SH-RS07465-5825S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS07465 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT18-3649HCL | Recombinant Human NUDT18 293 Cell Lysate | +Inquiry |
PIK3R1-3185HCL | Recombinant Human PIK3R1 293 Cell Lysate | +Inquiry |
CCNT2-7701HCL | Recombinant Human CCNT2 293 Cell Lysate | +Inquiry |
PTGS2-643HCL | Recombinant Human PTGS2 cell lysate | +Inquiry |
NP-479HCL | Recombinant H2N2 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All erg24 Products
Required fields are marked with *
My Review for All erg24 Products
Required fields are marked with *
0
Inquiry Basket