Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor-Like Protein G(Crlg) Protein, His-Tagged
Cat.No. : | RFL15362DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cyclic AMP receptor-like protein G(crlG) Protein (Q54WN6) (1-515aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-515) |
Form : | Lyophilized powder |
AA Sequence : | MSSIIFIPNDADNINSIMVTISSSLSLVGCLFILSIYIYYKELREFQLKLIFIMTINDFI ISIIFLIATHIQTKYFDAITNVFPFFCNFPDSLLHYFFLSSFFWEVCIAHTLIQVIKYNN DKVEDNLKKYFIFSNGLSALIMVSLFFIRSYSKIDCHHDSIFPHLLFFIPLLLTWIYNII VCALLTKTFKEQAMNFGYSLGINGGSGSYINFTNNNSIDNYSNIIIKNDLIINNNNNINV NNNNNNINILFHVNVNNNNNKIIIKRIRKTPNIIWTSIFFLFSFGFIWSWSILVIILKYL SLDVKYILMISYFFIPLHGCMNAVCFGVNDRLRMNLKKSCKNYYYKFLGLFSLDKRKSYG INGNNKNNKNNNGANCEERSLIDYSPDDDDDEDDDNNNNNYSDGNYYQIPSPFLIDSRNS SNLTDYSVILDNNNNNNNNGPYNPTRSNSITELLYNNINSLNAIRILSNNNNNNNNNNNN NNNNNNNNNNINNNDNNNNNNNNNSFCTIDEDETK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crlG |
Synonyms | crlG; DDB_G0279599; Cyclic AMP receptor-like protein G |
UniProt ID | Q54WN6 |
◆ Recombinant Proteins | ||
Kitl-575M | Active Recombinant Mouse Kitl protein(Met1-Ala189), His-tagged | +Inquiry |
CPT1B-1455H | Recombinant Human CPT1B protein, His & T7-tagged | +Inquiry |
SIP1-2677H | Recombinant Human SIP1, GST-tagged | +Inquiry |
IL15 & IL15RA-1292H | Recombinant Human IL15 & IL15RA protein(Ile31-Asp96 & Asn22-Ser135), hFc-tagged | +Inquiry |
RFL31816RF | Recombinant Full Length Rat Phosphate Carrier Protein, Mitochondrial(Slc25A3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABTB1-13HCL | Recombinant Human ABTB1 cell lysate | +Inquiry |
NT5E-1082RCL | Recombinant Rat NT5E cell lysate | +Inquiry |
NEGR1-2031HCL | Recombinant Human NEGR1 cell lysate | +Inquiry |
Testis-656B | Bovine Testis Lysate, Total Protein | +Inquiry |
PLRG1-1380HCL | Recombinant Human PLRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crlG Products
Required fields are marked with *
My Review for All crlG Products
Required fields are marked with *
0
Inquiry Basket