Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor-Like Protein D(Crld) Protein, His-Tagged
Cat.No. : | RFL35616DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cyclic AMP receptor-like protein D(crlD) Protein (Q54QV5) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MSSCSSLSMDDRVKIGYGSIAGASLSIIGSIGTIILIKIRNKKQEKKLLIQRKQQLSINN LNINSGSSSNIITISNSTTSLSSNNLNIQPPSFPSYSPLPTSISLSNNNNNNKNNNQKTK VSHFIINLSIANLLASIFMITIKLMMIHFNDKFIKVLPSTANHSFNALISVCTIGNGVIG FSFISTFFWTLAISMYIYQQFLSSSTINSNNNNNNINNINNNNNNNINNINNSKNNNSIN NFNNSNKSNKIIKMLFYFVCWVIPFVLGSILVSGSRLIELNSDLPWCSIDSNIQLISFYF PLIICLLATTFFTILIKYKFSNDKLACSSSSLINLQSKIIQRLILFLIVILVCWVPSLIS FFISFFSKNCKQFLWLEIISSTIQSCQGILNFLSYLSIFKKLKLYFKNLKKKFNNNNSNN SNNSNNNNSNNFNGGGIFYSKGKKVNNQNSNNFYFTFSTFDFDNNQIQEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crlD |
Synonyms | crlD; DDB_G0283579; Cyclic AMP receptor-like protein D |
UniProt ID | Q54QV5 |
◆ Recombinant Proteins | ||
ADRB2-2352H | Recombinant Human ADRB2(G16R,E27Q) Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
GDI2-636H | Recombinant Human GDI2 Protein, MYC/DDK-tagged | +Inquiry |
AHCYL2-1944HFL | Recombinant Full Length Human AHCYL2 Protein, C-Flag-tagged | +Inquiry |
RFL12141AF | Recombinant Full Length Apis Florea Cytochrome C Oxidase Subunit 2(Coii) Protein, His-Tagged | +Inquiry |
DSG3-2827H | Recombinant Human DSG3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKB-6959HCL | Recombinant Human DGKB 293 Cell Lysate | +Inquiry |
EXOSC7-6499HCL | Recombinant Human EXOSC7 293 Cell Lysate | +Inquiry |
TTC14-688HCL | Recombinant Human TTC14 293 Cell Lysate | +Inquiry |
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
Parietal Lobe-43H | Human Parietal Lobe Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crlD Products
Required fields are marked with *
My Review for All crlD Products
Required fields are marked with *
0
Inquiry Basket