Recombinant Full Length Dictyostelium Discoideum Abc Transporter G Family Member 22(Abcg22) Protein, His-Tagged
Cat.No. : | RFL3589DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum ABC transporter G family member 22(abcG22) Protein (Q55DA0) (1-615aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-615) |
Form : | Lyophilized powder |
AA Sequence : | MDQVSIEMSSTPRPTMVKSKSQLSLRRSLTITFKDLAYSVTVKKKKMQILKGVSGTVTPG ELVAVFGPSGSGKTTLLDILANRKESGEISGAVLINGNEIDDDYKRLCSYVVQEDVLLPT ITVRETLRFYADLKLPKSWTEKEKHERIEQILEQIGLSHRADAKIGGVLPGGIVLRGLSG GEKRRVSIGCGLVTSPSIVLLDEPTSGLDTTSAMAVMKTLVELTQQKSVTVICTIHQPRS EIFKLFTKIMVLAEGRLVYYGNRPVEHFTEIGFPFPDQTNPADYILDAVTTIKEEGRADE IADRLQSSYLDQANQESSSTLTQSQLGIINASGKRKINAYNNGLFTQFLVLWKRTGLDFI RNPSNCLVRFAVAVFVGLLFGACFSGLGMDEKGVQSRSAVLFYLVINMILQPFASISLFI SKRTLFNAERASKLYHTLPYYLALMFFEILACIGTAFILGTITYWFADLNPGADKYFFAM AILTLAHLAGDFFMLIISCITVQVDTSFAVGAGVATIYQLFAGFFVPINALPKSFEWLHW CNFVYYSFEALMHNEFVGETVNCGQLACPTGRDVLINLGLNNRGKGINLIIVSSFAFAFF TMVFLCLHYFHREKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | abcG22 |
Synonyms | abcG22; DDB_G0270826; ABC transporter G family member 22; ABC transporter ABCG.22 |
UniProt ID | Q55DA0 |
◆ Recombinant Proteins | ||
PPIF-13184M | Recombinant Mouse PPIF Protein | +Inquiry |
FGF14-566H | Active Recombinant Human FGF14 Protein | +Inquiry |
RFL5625HF | Recombinant Full Length Haemophilus Influenzae Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
MAP205-8283Z | Recombinant Zebrafish MAP205 | +Inquiry |
RFL13391BF | Recombinant Full Length Bovine Solute Carrier Family 25 Member 41(Slc25A41) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
Collagen-I-01M | Native Mouse Collagen-I Protein | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
RERGL-638HCL | Recombinant Human RERGL cell lysate | +Inquiry |
SIGLEC6-795HCL | Recombinant Human SIGLEC6 cell lysate | +Inquiry |
CRHBP-7280HCL | Recombinant Human CRHBP 293 Cell Lysate | +Inquiry |
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All abcG22 Products
Required fields are marked with *
My Review for All abcG22 Products
Required fields are marked with *
0
Inquiry Basket