Recombinant Full Length Desulfovibrio Salexigens Na(+)-Translocating Nadh-Quinone Reductase Subunit E Protein, His-Tagged
Cat.No. : | RFL18068DF |
Product Overview : | Recombinant Full Length Desulfovibrio salexigens Na(+)-translocating NADH-quinone reductase subunit E Protein (C6BWF6) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfovibrio salexigens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MEHLVNIFVKSIFIENLALAFFLGMCTYLAVSKKVQTSMGLGVAVIVVMTITVPVNNLLY NYFLREGALAWAGFGDTDLTFVGLISYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLI TVNCAILGASLFMVERDYNFVESVTFGFGSGVGWALAIVLLAGIREKMKYSDVPEGLDGL GITFIVVGLMSFGFLSFSGIQM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; Desal_0333; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | C6BWF6 |
◆ Recombinant Proteins | ||
Cpped1-1918M | Recombinant Mouse Cpped1 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP35-5578HF | Recombinant Full Length Human ARHGAP35 Protein, GST-tagged | +Inquiry |
CBFB-9893Z | Recombinant Zebrafish CBFB | +Inquiry |
AHSP-370H | Recombinant Human ERAF, None tagged | +Inquiry |
GRAP-5310HF | Recombinant Full Length Human GRAP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF529-57HCL | Recombinant Human ZNF529 293 Cell Lysate | +Inquiry |
BPI-1493HCL | Recombinant Human BPI cell lysate | +Inquiry |
IGHA2-839HCL | Recombinant Human IGHA2 cell lysate | +Inquiry |
IFNA5-001MCL | Recombinant Mouse IFNA5 cell lysate | +Inquiry |
CNTNAP2-2194MCL | Recombinant Mouse CNTNAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket