Recombinant Full Length Pseudoalteromonas Atlantica Na(+)-Translocating Nadh-Quinone Reductase Subunit E(Nqre) Protein, His-Tagged
Cat.No. : | RFL3722PF |
Product Overview : | Recombinant Full Length Pseudoalteromonas atlantica Na(+)-translocating NADH-quinone reductase subunit E(nqrE) Protein (Q15YQ2) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudoalteromonas atlantica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MEQYLSLFIRSIFLENMALFYFLGMCTFLAVSKKVKTAMGLGVAVIVVLTISVPVNQLVY ANILAPGALGWAGFPDTDLSFLSFLTFIGVIAALVQILEMTLDKFFPALYNALGIFLPLI TVNCAIFGGVAFAVQRDYTFTESIFYGAGSGAGWALAITLLAAVREKLKYADMPEGVRGL GSVFMIAGLMALGFQSFSGVSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; Patl_0456; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | Q15YQ2 |
◆ Native Proteins | ||
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
Lectin-1810M | Active Native Maclura Pomifera Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
PTER-2720HCL | Recombinant Human PTER 293 Cell Lysate | +Inquiry |
KLF16-939HCL | Recombinant Human KLF16 cell lysate | +Inquiry |
GBA3-661HCL | Recombinant Human GBA3 cell lysate | +Inquiry |
GPATCH3-5817HCL | Recombinant Human GPATCH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket