Recombinant Full Length Deinococcus Radiodurans C4-Dicarboxylate Transport Protein(Dcta) Protein, His-Tagged
Cat.No. : | RFL23877DF |
Product Overview : | Recombinant Full Length Deinococcus radiodurans C4-dicarboxylate transport protein(dctA) Protein (Q9RRG7) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Deinococcus radiodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MPKIFRSLYVQVIIAIVLGILVGALFPKFGEALKPLGDIFVKLIKMVIAPIIFATVVSGV AHMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLRPGAGMNVDPATLDTAGLTKYT EAAGEMTVWDHILKIIPDTLVSAFTGGELLPVLLVALLFGFALMRLGKLGDQILYGIDAL NQVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLTSLGYLMGSFYLTCLLFIFVVLGLI ARAAGFSIFKLIRYIREELLIVLGTSSSESALPRLMMKLEHAGAEKSVVGLVVPTGYSFN LDGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLLLTSKGAAGVTGSGFITLAATLGAV GHVPVAGMALILGIDRFMSEARALTNFIGNAVATLVVARSENAVDMNRLTRALNGEDLPT TEPDVASEERGEGREIDSSRPVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA |
Synonyms | dctA; DR_2525; C4-dicarboxylate transport protein |
UniProt ID | Q9RRG7 |
◆ Recombinant Proteins | ||
FBXO18-28815TH | Recombinant Human FBXO18, His-tagged | +Inquiry |
CPLX1-1705H | Recombinant Human CPLX1 Protein (Met1-Lys134), His tagged | +Inquiry |
SPATA21-706C | Recombinant Cynomolgus Monkey SPATA21 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP048A-028-4118S | Recombinant Staphylococcus aureus (strain: NE 3809) SAP048A_028 protein, His-tagged | +Inquiry |
Gli1-139R | Recombinant Rat Gli1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
PLG-8H | Native Human Plasminogen, FITC Labeled | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC9-7742HCL | Recombinant Human CCDC9 293 Cell Lysate | +Inquiry |
STC2-849HCL | Recombinant Human STC2 cell lysate | +Inquiry |
ALMS1P-4700HCL | Recombinant Human LOC200420 293 Cell Lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Appendix-19H | Human Appendix Lupus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctA Products
Required fields are marked with *
My Review for All dctA Products
Required fields are marked with *
0
Inquiry Basket