Recombinant Full Length Dehalococcoides Sp. Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL26294DF |
Product Overview : | Recombinant Full Length Dehalococcoides sp. Protein translocase subunit SecD(secD) Protein (D2BGI6) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dehalococcoides mccartyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MRRKNGLVFLAILAAMILAFTIVLPTDKGALLGKGILFGLDLKGGLHMVYQADLSNVDES NIDGVMDGVVEVISNRINPLGVTEASIQRQGDDRIVVELPGLDITDEQKARIGRTALLEF GELAADGEDYKWENSLGKWKPATATIDGVEYTLTSAYFKDSTYVNRDQYGNILLVFEWDD IGAQLSKEITTRLLNQQLGIFEGDEALSGDNGIPIAPVINNVIETSGVIEGLSYNEAEML SNQLNAGRLPVPLEPIYEQTVSPTLGQNFVDLAVKAGLVGIILVMIFMIAFYRLPGLLAS IALVFYGVIVLALFKLVPVTLTLAGIGGFIVSAGMAVDANILIFARLKEELLTGKTLGAA VEAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAGAPVKGFAVTLFLGVAVSMFTAIFV TRTLLRLFVGTKTGKKLALFTTQTRGKNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; DhcVS_275; Protein translocase subunit SecD |
UniProt ID | D2BGI6 |
◆ Recombinant Proteins | ||
Itsn1-1702M | Recombinant Mouse Itsn1 Protein, His-tagged | +Inquiry |
Cadm1-1180M | Recombinant Mouse Cadm1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc41a3-5934M | Recombinant Mouse Slc41a3 Protein, Myc/DDK-tagged | +Inquiry |
RFL11969GF | Recombinant Full Length Chicken Voltage-Dependent L-Type Calcium Channel Subunit Alpha-1C(Cacna1C) Protein, His-Tagged | +Inquiry |
HLA-A&B2M-1534H | Recombinant Human HLA-A&B2M protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
KS-01G | Active Native Goat KS Protein | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
ALB-128C | Native Canine Serum Albumin | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH10-4475HCL | Recombinant Human MARCH10 293 Cell Lysate | +Inquiry |
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
BCL2L15-8483HCL | Recombinant Human BCL2L15 293 Cell Lysate | +Inquiry |
DCLRE1B-7050HCL | Recombinant Human DCLRE1B 293 Cell Lysate | +Inquiry |
PILRB-1617MCL | Recombinant Mouse PILRB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket