Recombinant Full Length Debaryomyces Hansenii Ph-Response Regulator Protein Pali/Rim9(Rim9) Protein, His-Tagged
Cat.No. : | RFL26598DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii pH-response regulator protein palI/RIM9(RIM9) Protein (Q6BNJ2) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MHKGLLILDLFVSICLTIQLLPIISVPITGKGIGYNLHLSKYGNYTFGVLGLCTSNNICS KPKVGYPPETDAFYSFMDDENGEYPDFAAAELPSRARYVISKLLVVHIVGFCFTTLLFLL SLALTVILWLEESETKVPFKDAVRKKVKIRQNSRNNSSTELTESTSATKMNSLSDEGTVD NERKSKDITPYLNFMLMLSLLSFLSTLLAFLSDILLFIPHLSYLGWLQLCPIILLSTVTS MLCFIKRSISSRKYLNDEYRYENDDMRKSVNVGVLNWKDTDSDDGFYVYTNGFYSNYNND DTPQEGHSHAPELFPANISTHSGWIRHSGHNETGDDVSISSSRDDSYNEHENIQMRLLND HEHIT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM9 |
Synonyms | RIM9; DEHA2E21252g; pH-response regulator protein palI/RIM9 |
UniProt ID | Q6BNJ2 |
◆ Recombinant Proteins | ||
FRK-1408H | Active Recombinant Human FRK, GST-tagged | +Inquiry |
LILRB1-131H | Recombinant Human leukocyte immunoglobulin like receptor B1 Protein, His&Flag tagged | +Inquiry |
MRAP2-965H | Recombinant Human MRAP2, His-tagged | +Inquiry |
MLF1-149H | Recombinant Human MLF1 protein, T7-tagged | +Inquiry |
PF3D7_1471100-5553P | Recombinant Plasmodium falciparum PF3D7_1471100 Protein (Val22-Glu287), N-His tagged | +Inquiry |
◆ Native Proteins | ||
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKN1-1363HCL | Recombinant Human PKN1 cell lysate | +Inquiry |
IFNA8-1035CCL | Recombinant Cynomolgus IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
HS2ST1-5388HCL | Recombinant Human HS2ST1 293 Cell Lysate | +Inquiry |
NCOA4-3940HCL | Recombinant Human NCOA4 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RIM9 Products
Required fields are marked with *
My Review for All RIM9 Products
Required fields are marked with *
0
Inquiry Basket