Recombinant Full Length Daucus Carota Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL30043DF |
Product Overview : | Recombinant Full Length Daucus carota NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q0G9Q7) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Carrot |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQAINSFFRLESLKEVYDIIWMLVPILTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVTSILLSYLVIPFGY RLVLADVSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSLPHIALPFFFEINKAGRV FGTIIGIFITLAKTYLFLFIAITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q0G9Q7 |
◆ Native Proteins | ||
ORM1-26392TH | Native Human ORM1 | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNE2-5065HCL | Recombinant Human KCNE2 293 Cell Lysate | +Inquiry |
SPINT1-2027HCL | Recombinant Human SPINT1 cell lysate | +Inquiry |
Liver-540E | Equine Liver Lysate, Total Protein | +Inquiry |
KRT76-957HCL | Recombinant Human KRT76 cell lysate | +Inquiry |
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket