Recombinant Full Length Danio Rerio Transmembrane Protein 161B(Tmem161B) Protein, His-Tagged
Cat.No. : | RFL35099DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 161B(tmem161b) Protein (Q7SY10) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MGVISVQLVVTMVMASVIQKIIPHYSFARWLLCSGSLRWYQHPTEDELRTLAGKQQKGGK SKKDRKYNGHLENKPMTIPKDIDLQLETKCIAEVDTLALHYFPEFQWLVDFTVAATVVYL ITELYFCVAEPSGEMNISVVWSLLVLAFVMKILFSLTAHYFRLEEGGERSLCITFAFFFF VKAMAILIVTENYLEFGLETGFANFSESAVQFLENQGLESQGPISKLTFKLILALLCALI GAFLTFPGLRLAQMHLDALTLNNCKVTQTLLHINFLAPLIMVLLWVKPITKDYITNPTFG KDNVPLMSEKTYDTLRLWVILLLCVLRLAMMRHHLQAYLNLAQKGVLQMKKEAGRISTVD LQKMVARVFYYLCVIALQYIAPLVMLLHTTLLLKTLGGHSWVIYSDESLPCLSNEDSSPA EVGQSQMEASQTVAQLSVALGGLRTVFSPLLFRGLLSFFTWWIAACLFSTSLFGLFYHQY LMAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem161b |
Synonyms | tmem161b; si:dkey-195m1.1; zgc:63626; Transmembrane protein 161B |
UniProt ID | Q7SY10 |
◆ Recombinant Proteins | ||
CAMKK1-1390H | Recombinant Human CAMKK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NME1-4709H | Recombinant Human NME1 Protein (Met1-Glu152), N-His tagged | +Inquiry |
FAM135A-2988M | Recombinant Mouse FAM135A Protein, His (Fc)-Avi-tagged | +Inquiry |
KLF6-2809H | Recombinant Human KLF6 Protein (Met1-Ser109) | +Inquiry |
GRPCA-2720R | Recombinant Rat GRPCA Protein | +Inquiry |
◆ Native Proteins | ||
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry |
SK-MEL-5-063WCY | Human Skin Melanoma SK-MEL-5 Whole Cell Lysate | +Inquiry |
FAM76A-6350HCL | Recombinant Human FAM76A 293 Cell Lysate | +Inquiry |
LDB2-4791HCL | Recombinant Human LDB2 293 Cell Lysate | +Inquiry |
MAP3K3-4505HCL | Recombinant Human MAP3K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem161b Products
Required fields are marked with *
My Review for All tmem161b Products
Required fields are marked with *
0
Inquiry Basket